Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU19_RS00405 | Genome accession | NZ_CP111144 |
| Coordinates | 65609..66061 (-) | Length | 150 a.a. |
| NCBI ID | WP_078801814.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 45955..108517 | 65609..66061 | within | 0 |
Gene organization within MGE regions
Location: 45955..108517
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU19_RS00265 (ORU19_00265) | - | 45955..46992 (-) | 1038 | WP_225529672.1 | tyrosine-type recombinase/integrase | - |
| ORU19_RS00270 (ORU19_00270) | - | 47001..47387 (-) | 387 | WP_016533425.1 | hypothetical protein | - |
| ORU19_RS00275 (ORU19_00275) | - | 47503..47958 (-) | 456 | WP_014390696.1 | hypothetical protein | - |
| ORU19_RS00280 (ORU19_00280) | - | 48003..48356 (-) | 354 | WP_078801811.1 | hypothetical protein | - |
| ORU19_RS00285 (ORU19_00285) | - | 48365..48892 (-) | 528 | WP_078801812.1 | DUF551 domain-containing protein | - |
| ORU19_RS00290 (ORU19_00290) | rdgC | 49036..49938 (-) | 903 | Protein_51 | recombination-associated protein RdgC | - |
| ORU19_RS00295 (ORU19_00295) | - | 49941..50324 (-) | 384 | WP_078801813.1 | hypothetical protein | - |
| ORU19_RS00300 (ORU19_00300) | - | 50403..50714 (-) | 312 | WP_014390701.1 | DUF6378 domain-containing protein | - |
| ORU19_RS00305 (ORU19_00305) | - | 50714..51235 (-) | 522 | WP_014390702.1 | MazG-like family protein | - |
| ORU19_RS00310 (ORU19_00310) | - | 51526..51738 (-) | 213 | WP_005628486.1 | Gfo/Idh/MocA family oxidoreductase | - |
| ORU19_RS00315 (ORU19_00315) | - | 51834..52520 (-) | 687 | WP_041422865.1 | DUF4405 domain-containing protein | - |
| ORU19_RS00320 (ORU19_00320) | - | 52570..52863 (-) | 294 | WP_005612106.1 | flavodoxin | - |
| ORU19_RS00325 (ORU19_00325) | - | 52777..53166 (+) | 390 | WP_076090694.1 | IS1 family transposase | - |
| ORU19_RS00330 (ORU19_00330) | - | 53220..53369 (+) | 150 | Protein_59 | arsenical-resistance protein | - |
| ORU19_RS00335 (ORU19_00335) | - | 53439..54986 (-) | 1548 | WP_010907408.1 | multicopper oxidase family protein | - |
| ORU19_RS00340 (ORU19_00340) | - | 54998..55453 (-) | 456 | WP_010907409.1 | DUF411 domain-containing protein | - |
| ORU19_RS00345 (ORU19_00345) | - | 55490..56167 (+) | 678 | WP_016533871.1 | zinc-binding dehydrogenase | - |
| ORU19_RS00350 (ORU19_00350) | - | 56220..56579 (-) | 360 | Protein_63 | arsenical-resistance protein | - |
| ORU19_RS00355 (ORU19_00355) | - | 56594..56992 (-) | 399 | WP_010907411.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| ORU19_RS00360 (ORU19_00360) | - | 57065..57679 (+) | 615 | WP_010907412.1 | cation diffusion facilitator family transporter | - |
| ORU19_RS00365 (ORU19_00365) | arsB | 57763..58779 (-) | 1017 | WP_010907413.1 | ACR3 family arsenite efflux transporter | - |
| ORU19_RS00370 (ORU19_00370) | arsC | 58783..59187 (-) | 405 | WP_010907414.1 | arsenate reductase (glutaredoxin) | - |
| ORU19_RS00375 (ORU19_00375) | - | 59252..59554 (-) | 303 | WP_014550505.1 | ArsR/SmtB family transcription factor | - |
| ORU19_RS00380 (ORU19_00380) | - | 59601..59975 (+) | 375 | WP_225529671.1 | LysR family transcriptional regulator | - |
| ORU19_RS00385 (ORU19_00385) | - | 60221..60631 (-) | 411 | WP_010907416.1 | hypothetical protein | - |
| ORU19_RS00390 (ORU19_00390) | - | 60633..62669 (-) | 2037 | WP_010907417.1 | integrase | - |
| ORU19_RS00395 (ORU19_00395) | - | 62672..64192 (-) | 1521 | WP_010907418.1 | site-specific integrase | - |
| ORU19_RS00400 (ORU19_00400) | - | 64179..65459 (-) | 1281 | WP_016533798.1 | site-specific integrase | - |
| ORU19_RS00405 (ORU19_00405) | ssb | 65609..66061 (-) | 453 | WP_078801814.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU19_RS00410 (ORU19_00410) | - | 66061..66720 (-) | 660 | WP_266212962.1 | translocation protein TolB precursor | - |
| ORU19_RS00415 (ORU19_00415) | - | 66707..67660 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| ORU19_RS00420 (ORU19_00420) | - | 67662..67949 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU19_RS00425 (ORU19_00425) | - | 67962..68198 (-) | 237 | WP_078801815.1 | hypothetical protein | - |
| ORU19_RS00430 (ORU19_00430) | - | 68170..68469 (-) | 300 | WP_266208799.1 | hypothetical protein | - |
| ORU19_RS00435 (ORU19_00435) | - | 68617..68847 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU19_RS00440 (ORU19_00440) | - | 68910..69551 (-) | 642 | WP_078801817.1 | Bro-N domain-containing protein | - |
| ORU19_RS00445 (ORU19_00445) | - | 69833..70375 (-) | 543 | WP_078737823.1 | DUF4760 domain-containing protein | - |
| ORU19_RS00450 (ORU19_00450) | - | 71019..71213 (+) | 195 | WP_078737822.1 | hypothetical protein | - |
| ORU19_RS00455 (ORU19_00455) | - | 71194..71364 (-) | 171 | WP_155295599.1 | hypothetical protein | - |
| ORU19_RS00460 (ORU19_00460) | - | 71377..71607 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU19_RS00465 (ORU19_00465) | - | 71849..72058 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU19_RS00470 (ORU19_00470) | - | 72071..72238 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU19_RS00475 (ORU19_00475) | - | 72594..73418 (-) | 825 | WP_014390716.1 | DUF3037 domain-containing protein | - |
| ORU19_RS00480 (ORU19_00480) | - | 73415..74152 (-) | 738 | WP_014390717.1 | HipA family kinase | - |
| ORU19_RS00485 (ORU19_00485) | - | 74228..74914 (-) | 687 | WP_014391464.1 | XRE family transcriptional regulator | - |
| ORU19_RS00490 (ORU19_00490) | - | 75042..75251 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| ORU19_RS00495 (ORU19_00495) | - | 75300..75752 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| ORU19_RS00500 (ORU19_00500) | - | 75811..76512 (+) | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU19_RS00505 (ORU19_00505) | - | 76509..76862 (+) | 354 | WP_014390722.1 | HNH endonuclease | - |
| ORU19_RS00510 (ORU19_00510) | - | 76864..77835 (+) | 972 | WP_266212964.1 | hypothetical protein | - |
| ORU19_RS00515 (ORU19_00515) | - | 77835..78530 (+) | 696 | WP_078801819.1 | replication protein P | - |
| ORU19_RS00520 (ORU19_00520) | - | 78523..79053 (+) | 531 | WP_078801820.1 | MT-A70 family methyltransferase | - |
| ORU19_RS00525 (ORU19_00525) | - | 79062..79499 (+) | 438 | WP_064965060.1 | DUF1367 family protein | - |
| ORU19_RS00530 (ORU19_00530) | - | 79659..79874 (+) | 216 | WP_078801821.1 | hypothetical protein | - |
| ORU19_RS00535 (ORU19_00535) | - | 79867..80469 (+) | 603 | WP_266208798.1 | recombination protein NinG | - |
| ORU19_RS00540 (ORU19_00540) | - | 80471..80932 (+) | 462 | WP_078801823.1 | antiterminator Q family protein | - |
| ORU19_RS00550 (ORU19_00550) | - | 81259..81519 (+) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| ORU19_RS00555 (ORU19_00555) | - | 81516..82046 (+) | 531 | WP_266212965.1 | lysozyme | - |
| ORU19_RS00560 (ORU19_00560) | - | 82019..82342 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU19_RS00565 (ORU19_00565) | - | 82564..82998 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ORU19_RS00570 (ORU19_00570) | - | 83027..83209 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| ORU19_RS00575 (ORU19_00575) | - | 83292..83789 (+) | 498 | WP_014390737.1 | terminase | - |
| ORU19_RS00580 (ORU19_00580) | - | 83773..84999 (+) | 1227 | WP_078801824.1 | PBSX family phage terminase large subunit | - |
| ORU19_RS00585 (ORU19_00585) | - | 85014..86459 (+) | 1446 | WP_014390739.1 | anti-CBASS protein Acb1 family protein | - |
| ORU19_RS00590 (ORU19_00590) | - | 86413..87384 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| ORU19_RS00595 (ORU19_00595) | - | 87399..88745 (+) | 1347 | WP_014390741.1 | DUF2213 domain-containing protein | - |
| ORU19_RS00600 (ORU19_00600) | - | 88745..89179 (+) | 435 | WP_014390742.1 | hypothetical protein | - |
| ORU19_RS00605 (ORU19_00605) | - | 89266..90189 (+) | 924 | WP_250021448.1 | major capsid protein | - |
| ORU19_RS00610 (ORU19_00610) | - | 90200..90478 (+) | 279 | WP_265164216.1 | hypothetical protein | - |
| ORU19_RS00615 (ORU19_00615) | - | 90459..90827 (+) | 369 | WP_014390745.1 | hypothetical protein | - |
| ORU19_RS00620 (ORU19_00620) | - | 90830..91174 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| ORU19_RS00625 (ORU19_00625) | - | 91179..91550 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| ORU19_RS00630 (ORU19_00630) | - | 91547..91918 (+) | 372 | WP_014390748.1 | hypothetical protein | - |
| ORU19_RS00635 (ORU19_00635) | - | 91930..92412 (+) | 483 | WP_014390749.1 | phage tail tube protein | - |
| ORU19_RS00640 (ORU19_00640) | - | 92466..93137 (+) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| ORU19_RS00645 (ORU19_00645) | - | 93214..93570 (+) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| ORU19_RS00650 (ORU19_00650) | - | 93646..94464 (-) | 819 | WP_014390752.1 | hypothetical protein | - |
| ORU19_RS00655 (ORU19_00655) | - | 94803..95627 (+) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| ORU19_RS00660 (ORU19_00660) | - | 95679..98123 (+) | 2445 | WP_014390755.1 | phage tail length tape measure family protein | - |
| ORU19_RS00665 (ORU19_00665) | - | 98126..98455 (+) | 330 | WP_014390756.1 | phage tail protein | - |
| ORU19_RS00670 (ORU19_00670) | - | 98584..99288 (+) | 705 | WP_078801828.1 | phage minor tail protein L | - |
| ORU19_RS00675 (ORU19_00675) | - | 99293..100036 (+) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU19_RS00680 (ORU19_00680) | - | 99979..100599 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU19_RS00685 (ORU19_00685) | - | 100603..106497 (+) | 5895 | WP_266212967.1 | phage tail protein | - |
| ORU19_RS00690 (ORU19_00690) | - | 106545..106868 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| ORU19_RS00695 (ORU19_00695) | - | 107259..108005 (-) | 747 | WP_014390762.1 | hypothetical protein | - |
| ORU19_RS00700 (ORU19_00700) | - | 108005..108517 (-) | 513 | WP_014390763.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17107.99 Da Isoelectric Point: 7.9707
>NTDB_id=758122 ORU19_RS00405 WP_078801814.1 65609..66061(-) (ssb) [Pasteurella multocida strain PF7]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=758122 ORU19_RS00405 WP_078801814.1 65609..66061(-) (ssb) [Pasteurella multocida strain PF7]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
60.556 |
100 |
0.727 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
92.667 |
0.487 |
| ssb | Neisseria gonorrhoeae MS11 |
44.526 |
91.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
44.526 |
91.333 |
0.407 |