Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU17_RS00300 | Genome accession | NZ_CP111143 |
| Coordinates | 51153..51605 (-) | Length | 150 a.a. |
| NCBI ID | WP_078802173.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF6 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 45806..105218 | 51153..51605 | within | 0 |
Gene organization within MGE regions
Location: 45806..105218
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU17_RS00255 (ORU17_00255) | - | 45806..46843 (-) | 1038 | WP_016533424.1 | tyrosine-type recombinase/integrase | - |
| ORU17_RS00260 (ORU17_00260) | - | 46852..47238 (-) | 387 | WP_016533425.1 | hypothetical protein | - |
| ORU17_RS00265 (ORU17_00265) | - | 47354..47809 (-) | 456 | WP_014390696.1 | hypothetical protein | - |
| ORU17_RS00270 (ORU17_00270) | - | 47854..48207 (-) | 354 | WP_078801811.1 | hypothetical protein | - |
| ORU17_RS00275 (ORU17_00275) | - | 48216..48743 (-) | 528 | WP_078801812.1 | DUF551 domain-containing protein | - |
| ORU17_RS00280 (ORU17_00280) | rdgC | 48887..49789 (-) | 903 | WP_014667784.1 | recombination-associated protein RdgC | - |
| ORU17_RS00285 (ORU17_00285) | - | 49792..50175 (-) | 384 | WP_078801813.1 | hypothetical protein | - |
| ORU17_RS00290 (ORU17_00290) | - | 50254..50565 (-) | 312 | WP_014390701.1 | DUF6378 domain-containing protein | - |
| ORU17_RS00295 (ORU17_00295) | - | 50565..51086 (-) | 522 | WP_014390702.1 | MazG-like family protein | - |
| ORU17_RS00300 (ORU17_00300) | ssb | 51153..51605 (-) | 453 | WP_078802173.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU17_RS00305 (ORU17_00305) | - | 51605..52264 (-) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| ORU17_RS00310 (ORU17_00310) | - | 52251..53204 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| ORU17_RS00315 (ORU17_00315) | - | 53206..53493 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU17_RS00320 (ORU17_00320) | - | 53506..53742 (-) | 237 | WP_078801815.1 | hypothetical protein | - |
| ORU17_RS00325 (ORU17_00325) | - | 53714..54013 (-) | 300 | WP_014391453.1 | hypothetical protein | - |
| ORU17_RS00330 (ORU17_00330) | - | 54161..54391 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU17_RS00335 (ORU17_00335) | - | 54454..55095 (-) | 642 | WP_078801817.1 | Bro-N domain-containing protein | - |
| ORU17_RS00340 (ORU17_00340) | - | 55377..55919 (-) | 543 | WP_078737823.1 | DUF4760 domain-containing protein | - |
| ORU17_RS00345 (ORU17_00345) | - | 56563..56757 (+) | 195 | WP_078737822.1 | hypothetical protein | - |
| ORU17_RS00350 (ORU17_00350) | - | 56738..56908 (-) | 171 | WP_155295599.1 | hypothetical protein | - |
| ORU17_RS00355 (ORU17_00355) | - | 56921..57151 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU17_RS00360 (ORU17_00360) | - | 57393..57602 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU17_RS00365 (ORU17_00365) | - | 57615..57782 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU17_RS00370 (ORU17_00370) | - | 58138..58962 (-) | 825 | WP_014390716.1 | DUF3037 domain-containing protein | - |
| ORU17_RS00375 (ORU17_00375) | - | 58959..59696 (-) | 738 | WP_014390717.1 | HipA family kinase | - |
| ORU17_RS00380 (ORU17_00380) | - | 59772..60458 (-) | 687 | WP_014391464.1 | XRE family transcriptional regulator | - |
| ORU17_RS00385 (ORU17_00385) | - | 60586..60795 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| ORU17_RS00390 (ORU17_00390) | - | 60844..61296 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| ORU17_RS00395 (ORU17_00395) | - | 61355..62056 (+) | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU17_RS00400 (ORU17_00400) | - | 62053..62406 (+) | 354 | WP_014390722.1 | HNH endonuclease | - |
| ORU17_RS00405 (ORU17_00405) | - | 62408..63379 (+) | 972 | WP_128597130.1 | hypothetical protein | - |
| ORU17_RS00410 (ORU17_00410) | - | 63379..64074 (+) | 696 | WP_078801819.1 | replication protein P | - |
| ORU17_RS00415 (ORU17_00415) | - | 64067..64597 (+) | 531 | WP_078801820.1 | MT-A70 family methyltransferase | - |
| ORU17_RS00420 (ORU17_00420) | - | 64606..65043 (+) | 438 | WP_064965060.1 | DUF1367 family protein | - |
| ORU17_RS00425 (ORU17_00425) | - | 65203..65418 (+) | 216 | WP_078801821.1 | hypothetical protein | - |
| ORU17_RS00430 (ORU17_00430) | - | 65411..66013 (+) | 603 | WP_078801822.1 | recombination protein NinG | - |
| ORU17_RS00435 (ORU17_00435) | - | 66015..66476 (+) | 462 | WP_078801823.1 | antiterminator Q family protein | - |
| ORU17_RS00445 (ORU17_00445) | - | 66803..67063 (+) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| ORU17_RS00450 (ORU17_00450) | - | 67060..67590 (+) | 531 | WP_078737811.1 | lysozyme | - |
| ORU17_RS00455 (ORU17_00455) | - | 67563..67886 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU17_RS00460 (ORU17_00460) | - | 68108..68542 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ORU17_RS00465 (ORU17_00465) | - | 68571..68753 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| ORU17_RS00470 (ORU17_00470) | - | 68836..69333 (+) | 498 | WP_014390737.1 | terminase | - |
| ORU17_RS00475 (ORU17_00475) | - | 69317..70543 (+) | 1227 | WP_266199975.1 | PBSX family phage terminase large subunit | - |
| ORU17_RS00480 (ORU17_00480) | - | 70558..72003 (+) | 1446 | WP_014390739.1 | anti-CBASS protein Acb1 family protein | - |
| ORU17_RS00485 (ORU17_00485) | - | 71957..72928 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| ORU17_RS00490 (ORU17_00490) | - | 72943..74289 (+) | 1347 | WP_014390741.1 | DUF2213 domain-containing protein | - |
| ORU17_RS00495 (ORU17_00495) | - | 74289..74723 (+) | 435 | WP_014390742.1 | hypothetical protein | - |
| ORU17_RS00500 (ORU17_00500) | - | 74735..75733 (+) | 999 | WP_078801825.1 | major capsid protein | - |
| ORU17_RS00505 (ORU17_00505) | - | 75744..76193 (+) | 450 | WP_266199976.1 | hypothetical protein | - |
| ORU17_RS00510 (ORU17_00510) | - | 76174..76542 (+) | 369 | WP_014390745.1 | hypothetical protein | - |
| ORU17_RS00515 (ORU17_00515) | - | 76545..76889 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| ORU17_RS00520 (ORU17_00520) | - | 76894..77265 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| ORU17_RS00525 (ORU17_00525) | - | 77262..77633 (+) | 372 | WP_014390748.1 | hypothetical protein | - |
| ORU17_RS00530 (ORU17_00530) | - | 77645..78127 (+) | 483 | WP_014390749.1 | phage tail tube protein | - |
| ORU17_RS00535 (ORU17_00535) | - | 78181..78852 (+) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| ORU17_RS00540 (ORU17_00540) | - | 78929..79285 (+) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| ORU17_RS00545 (ORU17_00545) | - | 79361..80179 (-) | 819 | WP_014390752.1 | hypothetical protein | - |
| ORU17_RS00550 (ORU17_00550) | - | 80518..81342 (+) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| ORU17_RS00555 (ORU17_00555) | - | 81394..83838 (+) | 2445 | WP_014390755.1 | phage tail length tape measure family protein | - |
| ORU17_RS00560 (ORU17_00560) | - | 83841..84170 (+) | 330 | WP_014390756.1 | phage tail protein | - |
| ORU17_RS00565 (ORU17_00565) | - | 84299..85003 (+) | 705 | WP_078801828.1 | phage minor tail protein L | - |
| ORU17_RS00570 (ORU17_00570) | - | 85008..85751 (+) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU17_RS00575 (ORU17_00575) | - | 85694..86314 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU17_RS00580 (ORU17_00580) | - | 86318..92212 (+) | 5895 | WP_266236336.1 | phage tail protein | - |
| ORU17_RS00585 (ORU17_00585) | - | 92260..92583 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| ORU17_RS00590 (ORU17_00590) | - | 92974..93720 (-) | 747 | WP_014390762.1 | hypothetical protein | - |
| ORU17_RS00595 (ORU17_00595) | - | 93720..94232 (-) | 513 | WP_014390763.1 | hypothetical protein | - |
| ORU17_RS00600 (ORU17_00600) | pnp | 94918..97062 (+) | 2145 | WP_005723319.1 | polyribonucleotide nucleotidyltransferase | - |
| ORU17_RS00605 (ORU17_00605) | nlpI | 97176..98042 (+) | 867 | WP_266200016.1 | lipoprotein NlpI | - |
| ORU17_RS00610 (ORU17_00610) | - | 98150..99982 (+) | 1833 | WP_005754621.1 | DEAD/DEAH box helicase | - |
| ORU17_RS00615 (ORU17_00615) | modD | 100078..100926 (-) | 849 | WP_005757236.1 | ModD protein | - |
| ORU17_RS00620 (ORU17_00620) | - | 100944..101543 (-) | 600 | WP_010907021.1 | ABC transporter ATP-binding protein | - |
| ORU17_RS00625 (ORU17_00625) | - | 101545..102342 (-) | 798 | WP_005723310.1 | ABC transporter permease | - |
| ORU17_RS00630 (ORU17_00630) | modA | 102317..103054 (-) | 738 | WP_005723309.1 | molybdate ABC transporter substrate-binding protein | - |
| ORU17_RS00635 (ORU17_00635) | groL | 103189..104832 (-) | 1644 | WP_005717462.1 | chaperonin GroEL | - |
| ORU17_RS00640 (ORU17_00640) | - | 104928..105218 (-) | 291 | WP_005717461.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17078.96 Da Isoelectric Point: 7.9721
>NTDB_id=758098 ORU17_RS00300 WP_078802173.1 51153..51605(-) (ssb) [Pasteurella multocida strain PF6]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=758098 ORU17_RS00300 WP_078802173.1 51153..51605(-) (ssb) [Pasteurella multocida strain PF6]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
60.556 |
100 |
0.727 |
| ssb | Vibrio cholerae strain A1552 |
53.237 |
92.667 |
0.493 |
| ssb | Neisseria gonorrhoeae MS11 |
45.985 |
91.333 |
0.42 |
| ssb | Neisseria meningitidis MC58 |
45.985 |
91.333 |
0.42 |