Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ORI84_RS06125 Genome accession   NZ_CP111083
Coordinates   1275608..1276057 (+) Length   149 a.a.
NCBI ID   WP_266199913.1    Uniprot ID   -
Organism   Pasteurella multocida strain PF4     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1237346..1280198 1275608..1276057 within 0


Gene organization within MGE regions


Location: 1237346..1280198
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORI84_RS05850 (ORI84_05825) - 1237346..1237669 (-) 324 WP_014667801.1 hypothetical protein -
  ORI84_RS05855 (ORI84_05830) - 1237717..1242720 (-) 5004 WP_397220885.1 phage tail protein -
  ORI84_RS05860 (ORI84_05835) - 1242724..1243344 (-) 621 WP_014667799.1 tail assembly protein -
  ORI84_RS05865 (ORI84_05840) - 1243287..1244030 (-) 744 WP_078801829.1 C40 family peptidase -
  ORI84_RS05870 (ORI84_05845) - 1244035..1244739 (-) 705 WP_078819787.1 phage minor tail protein L -
  ORI84_RS05875 (ORI84_05850) - 1244893..1245459 (-) 567 WP_078819667.1 hypothetical protein -
  ORI84_RS05880 (ORI84_05855) - 1245531..1245881 (-) 351 WP_005719622.1 phage tail protein -
  ORI84_RS05885 (ORI84_05860) - 1245878..1248250 (-) 2373 WP_078819786.1 phage tail length tape measure family protein -
  ORI84_RS05890 (ORI84_05865) - 1248237..1248542 (-) 306 WP_305953357.1 phage tail assembly protein T -
  ORI84_RS05895 (ORI84_05870) - 1248560..1248949 (-) 390 WP_016533230.1 phage minor tail protein G -
  ORI84_RS05900 (ORI84_05875) - 1248955..1249461 (-) 507 WP_078819785.1 phage tail tube protein -
  ORI84_RS05905 (ORI84_05880) gpU 1249458..1249865 (-) 408 WP_014391486.1 phage tail terminator protein -
  ORI84_RS05910 (ORI84_05885) - 1249862..1250413 (-) 552 WP_014391485.1 phage tail protein -
  ORI84_RS05915 (ORI84_05890) - 1250413..1250706 (-) 294 WP_014391484.1 hypothetical protein -
  ORI84_RS05920 (ORI84_05895) - 1250699..1251025 (-) 327 WP_266199907.1 DUF2190 family protein -
  ORI84_RS05925 (ORI84_05900) - 1251098..1253107 (-) 2010 WP_078819665.1 ClpP-like prohead protease/major capsid protein fusion protein -
  ORI84_RS05930 (ORI84_05905) - 1253043..1254581 (-) 1539 WP_016533224.1 phage portal protein -
  ORI84_RS05935 (ORI84_05910) - 1254578..1254799 (-) 222 WP_014391481.1 hypothetical protein -
  ORI84_RS05940 (ORI84_05915) - 1254796..1256904 (-) 2109 WP_014391480.1 phage terminase large subunit family protein -
  ORI84_RS05945 (ORI84_05920) - 1256908..1257381 (-) 474 WP_078819784.1 DUF1441 family protein -
  ORI84_RS05950 (ORI84_05925) - 1257671..1257931 (+) 261 WP_005720780.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ORI84_RS05955 (ORI84_05930) - 1257967..1258335 (+) 369 WP_014391478.1 helix-turn-helix transcriptional regulator -
  ORI84_RS05960 (ORI84_05935) - 1258545..1258868 (-) 324 WP_078801840.1 DUF2570 family protein -
  ORI84_RS05965 (ORI84_05940) - 1258841..1259371 (-) 531 WP_078737811.1 lysozyme -
  ORI84_RS05970 (ORI84_05945) - 1259368..1259628 (-) 261 WP_014391475.1 HP1 family phage holin -
  ORI84_RS05975 (ORI84_05950) - 1259746..1260309 (+) 564 WP_014667793.1 hypothetical protein -
  ORI84_RS05980 (ORI84_05955) - 1260435..1260896 (-) 462 WP_241952116.1 antiterminator Q family protein -
  ORI84_RS05985 (ORI84_05960) - 1260898..1261500 (-) 603 WP_250058251.1 recombination protein NinG -
  ORI84_RS05990 (ORI84_05965) - 1261493..1261708 (-) 216 WP_014667790.1 hypothetical protein -
  ORI84_RS05995 (ORI84_05970) - 1261782..1262240 (-) 459 WP_014391471.1 recombination protein NinB -
  ORI84_RS06000 (ORI84_05975) - 1262230..1262766 (-) 537 WP_178384709.1 phage N-6-adenine-methyltransferase -
  ORI84_RS06005 (ORI84_05980) - 1262770..1263459 (-) 690 WP_225529667.1 replication protein P -
  ORI84_RS06010 (ORI84_05985) - 1263459..1264274 (-) 816 WP_266199956.1 helix-turn-helix domain-containing protein -
  ORI84_RS06015 (ORI84_05990) - 1264271..1264486 (-) 216 WP_075271368.1 hypothetical protein -
  ORI84_RS06020 (ORI84_05995) - 1264483..1265166 (-) 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
  ORI84_RS06025 (ORI84_06000) - 1265227..1265688 (-) 462 WP_078802159.1 phage regulatory CII family protein -
  ORI84_RS06030 (ORI84_06005) - 1265738..1265935 (-) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  ORI84_RS06035 (ORI84_06010) - 1266059..1266736 (+) 678 WP_014390718.1 XRE family transcriptional regulator -
  ORI84_RS06040 (ORI84_06015) - 1266947..1268791 (+) 1845 WP_071523830.1 DEAD/DEAH box helicase -
  ORI84_RS06045 (ORI84_06020) - 1268821..1269225 (+) 405 WP_146024473.1 hypothetical protein -
  ORI84_RS06050 (ORI84_06025) - 1269251..1269541 (-) 291 WP_078819686.1 addiction module antidote protein -
  ORI84_RS06055 (ORI84_06030) - 1269538..1269852 (-) 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ORI84_RS06060 (ORI84_06035) - 1270157..1270324 (-) 168 WP_005756653.1 DUF1508 domain-containing protein -
  ORI84_RS06065 (ORI84_06040) - 1270337..1270546 (+) 210 WP_005756656.1 hypothetical protein -
  ORI84_RS06070 (ORI84_06045) - 1270788..1271018 (+) 231 WP_078737821.1 hypothetical protein -
  ORI84_RS06075 (ORI84_06050) - 1271031..1271201 (+) 171 WP_155295599.1 hypothetical protein -
  ORI84_RS06080 (ORI84_06055) - 1271182..1271376 (-) 195 WP_078737822.1 hypothetical protein -
  ORI84_RS06085 (ORI84_06060) - 1271588..1271851 (+) 264 WP_071522857.1 hypothetical protein -
  ORI84_RS06090 (ORI84_06065) - 1272098..1272760 (+) 663 WP_078737830.1 KilA-N domain-containing protein -
  ORI84_RS06095 (ORI84_06070) - 1272822..1273052 (-) 231 WP_223251317.1 hypothetical protein -
  ORI84_RS06100 (ORI84_06075) - 1273200..1273499 (+) 300 WP_014391453.1 hypothetical protein -
  ORI84_RS06105 (ORI84_06080) - 1273471..1273707 (+) 237 WP_078801815.1 hypothetical protein -
  ORI84_RS06110 (ORI84_06085) - 1273720..1274007 (+) 288 WP_014391452.1 hypothetical protein -
  ORI84_RS06115 (ORI84_06090) - 1274009..1274962 (+) 954 WP_014391451.1 recombinase RecT -
  ORI84_RS06120 (ORI84_06095) - 1274949..1275608 (+) 660 WP_041423209.1 translocation protein TolB precursor -
  ORI84_RS06125 (ORI84_06100) ssb 1275608..1276057 (+) 450 WP_266199913.1 single-stranded DNA-binding protein Machinery gene
  ORI84_RS06130 (ORI84_06105) rdgC 1276195..1277097 (+) 903 WP_014667784.1 recombination-associated protein RdgC -
  ORI84_RS06135 (ORI84_06110) - 1277241..1277771 (+) 531 WP_266199915.1 DUF551 domain-containing protein -
  ORI84_RS06140 (ORI84_06115) - 1277783..1278088 (+) 306 WP_108575008.1 hypothetical protein -
  ORI84_RS06145 (ORI84_06120) - 1278134..1278400 (+) 267 WP_064702824.1 hypothetical protein -
  ORI84_RS06150 (ORI84_06125) - 1278407..1278856 (+) 450 WP_266199916.1 pyruvate kinase -
  ORI84_RS06155 (ORI84_06130) - 1278931..1279212 (+) 282 WP_071523558.1 hypothetical protein -
  ORI84_RS06160 (ORI84_06135) - 1279209..1280198 (-) 990 WP_075266281.1 site-specific integrase -

Sequence

Protein


Download         Length: 149 a.a.        Molecular weight: 17024.90 Da        Isoelectric Point: 6.9835

>NTDB_id=757777 ORI84_RS06125 WP_266199913.1 1275608..1276057(+) (ssb) [Pasteurella multocida strain PF4]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=757777 ORI84_RS06125 WP_266199913.1 1275608..1276057(+) (ssb) [Pasteurella multocida strain PF4]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.752
  ssb Vibrio cholerae strain A1552

52.518

93.289

0.49
  ssb Neisseria meningitidis MC58

39.548

100

0.47
  ssb Neisseria gonorrhoeae MS11

43.796

91.946

0.403