Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   OQ483_RS02330 Genome accession   NZ_CP110985
Coordinates   478047..478532 (+) Length   161 a.a.
NCBI ID   WP_309257804.1    Uniprot ID   -
Organism   Enterobacter bugandensis strain E105227     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 465198..526300 478047..478532 within 0


Gene organization within MGE regions


Location: 465198..526300
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OQ483_RS02260 (OQ483_02250) - 465338..466255 (+) 918 WP_309257794.1 ParA family protein -
  OQ483_RS02265 (OQ483_02255) - 466252..466917 (+) 666 WP_309257795.1 hypothetical protein -
  OQ483_RS02270 (OQ483_02260) dnaB-PI 466910..468259 (+) 1350 WP_309257796.1 SPI-7-type island replicative DNA helicase -
  OQ483_RS02275 (OQ483_02265) - 468262..469998 (+) 1737 WP_309257797.1 ParB family protein -
  OQ483_RS02280 (OQ483_02270) - 469998..470720 (+) 723 WP_309257798.1 DUF2786 domain-containing protein -
  OQ483_RS02285 (OQ483_02275) - 470717..470938 (+) 222 WP_309257799.1 hypothetical protein -
  OQ483_RS02290 (OQ483_02280) - 470931..471560 (+) 630 WP_309257800.1 DUF2857 domain-containing protein -
  OQ483_RS02295 (OQ483_02285) - 471557..471820 (+) 264 WP_171887597.1 hypothetical protein -
  OQ483_RS02300 (OQ483_02290) - 471934..473208 (+) 1275 WP_309257801.1 STY4528 family pathogenicity island replication protein -
  OQ483_RS02305 (OQ483_02295) - 473216..473446 (+) 231 WP_309257802.1 hypothetical protein -
  OQ483_RS02310 (OQ483_02300) - 473466..474209 (+) 744 WP_197784807.1 PFL_4669 family integrating conjugative element protein -
  OQ483_RS02315 (OQ483_02305) - 474206..474778 (+) 573 WP_197806364.1 hypothetical protein -
  OQ483_RS02320 (OQ483_02310) - 474792..476831 (+) 2040 WP_309257803.1 DNA topoisomerase III -
  OQ483_RS02325 (OQ483_02315) - 477507..477974 (+) 468 WP_060558277.1 STY4534 family ICE replication protein -
  OQ483_RS02330 (OQ483_02320) ssb 478047..478532 (+) 486 WP_309257804.1 single-stranded DNA-binding protein Machinery gene
  OQ483_RS02335 (OQ483_02325) - 478611..479051 (+) 441 WP_099784035.1 DUF29 domain-containing protein -
  OQ483_RS02340 (OQ483_02330) - 479197..479841 (+) 645 WP_309257805.1 PilL N-terminal domain-containing protein -
  OQ483_RS02345 (OQ483_02335) - 479838..480581 (+) 744 WP_309257806.1 hypothetical protein -
  OQ483_RS02350 (OQ483_02340) - 480592..481302 (+) 711 WP_309258319.1 TIGR03759 family integrating conjugative element protein -
  OQ483_RS02355 (OQ483_02345) - 481281..481973 (+) 693 WP_309257807.1 transglycosylase SLT domain-containing protein -
  OQ483_RS02360 (OQ483_02350) - 481976..482500 (+) 525 WP_309257808.1 integrating conjugative element protein -
  OQ483_RS02365 (OQ483_02355) - 482497..483132 (+) 636 WP_309257809.1 restriction endonuclease -
  OQ483_RS02370 (OQ483_02360) - 483129..483902 (+) 774 WP_309257810.1 hypothetical protein -
  OQ483_RS02375 (OQ483_02365) traD 483899..486013 (+) 2115 WP_309257811.1 type IV conjugative transfer system coupling protein TraD -
  OQ483_RS02380 (OQ483_02370) - 485994..486752 (+) 759 WP_309257812.1 TIGR03747 family integrating conjugative element membrane protein -
  OQ483_RS02385 (OQ483_02375) - 486977..487306 (+) 330 WP_309257813.1 RAQPRD family integrative conjugative element protein -
  OQ483_RS02390 (OQ483_02380) - 487306..487548 (+) 243 WP_309257814.1 TIGR03758 family integrating conjugative element protein -
  OQ483_RS02395 (OQ483_02385) - 487612..487977 (+) 366 WP_309257815.1 TIGR03745 family integrating conjugative element membrane protein -
  OQ483_RS02400 (OQ483_02390) - 487989..488354 (+) 366 WP_309257816.1 TIGR03750 family conjugal transfer protein -
  OQ483_RS02405 (OQ483_02395) - 488351..489022 (+) 672 WP_309257817.1 PFL_4703 family integrating conjugative element protein -
  OQ483_RS02410 (OQ483_02400) - 489019..489930 (+) 912 WP_309257818.1 TIGR03749 family integrating conjugative element protein -
  OQ483_RS02415 (OQ483_02405) - 489923..491422 (+) 1500 WP_309257819.1 TIGR03752 family integrating conjugative element protein -
  OQ483_RS02420 (OQ483_02410) - 491452..491877 (+) 426 WP_309257820.1 TIGR03751 family conjugal transfer lipoprotein -
  OQ483_RS02425 (OQ483_02415) - 491877..494735 (+) 2859 WP_309258320.1 conjugative transfer ATPase -
  OQ483_RS02430 (OQ483_02420) - 494732..495136 (+) 405 WP_309257821.1 acetyltransferase -
  OQ483_RS02440 (OQ483_02430) - 496033..499293 (+) 3261 WP_309257822.1 hypothetical protein -
  OQ483_RS02445 (OQ483_02435) - 499477..499881 (+) 405 WP_309257823.1 TIGR03757 family integrating conjugative element protein -
  OQ483_RS02450 (OQ483_02440) - 499883..500890 (+) 1008 WP_309257824.1 TIGR03756 family integrating conjugative element protein -
  OQ483_RS02455 (OQ483_02445) - 500901..502382 (+) 1482 WP_309258321.1 integrating conjugative element protein -
  OQ483_RS02460 (OQ483_02450) - 502399..502770 (+) 372 WP_309257825.1 hypothetical protein -
  OQ483_RS02465 (OQ483_02455) - 502767..504305 (+) 1539 WP_309257826.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  OQ483_RS02470 (OQ483_02460) - 504345..504752 (-) 408 WP_309257827.1 hypothetical protein -
  OQ483_RS25785 - 505120..505386 (-) 267 WP_373569557.1 transposase family protein -
  OQ483_RS02480 (OQ483_02470) - 506025..508172 (+) 2148 WP_309257828.1 phosphatidylinositol-specific phospholipase C domain-containing protein -
  OQ483_RS02485 (OQ483_02475) - 508368..509212 (+) 845 WP_309257829.1 IS5 family transposase -
  OQ483_RS02490 (OQ483_02480) - 509598..510479 (-) 882 WP_309257830.1 hypothetical protein -
  OQ483_RS02500 (OQ483_02490) - 513623..514510 (+) 888 WP_309257832.1 integrase domain-containing protein -
  OQ483_RS02505 (OQ483_02495) - 514560..515369 (-) 810 WP_309257833.1 hypothetical protein -
  OQ483_RS02510 (OQ483_02500) - 515974..516315 (+) 342 WP_309257834.1 hypothetical protein -
  OQ483_RS02515 (OQ483_02505) - 516406..516771 (+) 366 WP_309257835.1 hypothetical protein -
  OQ483_RS02520 (OQ483_02510) - 516881..517804 (+) 924 WP_309257836.1 DUF1281 domain-containing protein -
  OQ483_RS02525 (OQ483_02515) - 517945..518640 (+) 696 WP_309257837.1 N-6 DNA methylase -
  OQ483_RS02530 (OQ483_02520) queF 518737..519573 (-) 837 WP_309257838.1 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF -
  OQ483_RS02535 (OQ483_02525) - 519564..520439 (-) 876 WP_309257839.1 queuosine precursor transporter -
  OQ483_RS02540 (OQ483_02530) - 520472..521083 (-) 612 WP_309258322.1 helix-turn-helix domain-containing protein -
  OQ483_RS02545 (OQ483_02535) - 521832..523280 (+) 1449 WP_309257840.1 UvrD-helicase domain-containing protein -
  OQ483_RS02550 (OQ483_02540) - 523274..524974 (+) 1701 WP_309257841.1 TraI domain-containing protein -
  OQ483_RS02555 (OQ483_02545) - 525042..526055 (+) 1014 WP_309257842.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 161 a.a.        Molecular weight: 17495.45 Da        Isoelectric Point: 5.6811

>NTDB_id=757287 OQ483_RS02330 WP_309257804.1 478047..478532(+) (ssb) [Enterobacter bugandensis strain E105227]
MASRGVNKVILVGHLGQDPEVRYMPNGGAVATLPLATSETWRDKQSGEQKEKTEWHRVVLFGKLAEIAGEYLRKGSQVYI
EGALRTRKWADQSGQDRYTTEVVINVGGTMQMLGGRSQTDNPGPSASGSWGQPQQPTHSGTPPQASAGNEPPMDFDDDIP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=757287 OQ483_RS02330 WP_309257804.1 478047..478532(+) (ssb) [Enterobacter bugandensis strain E105227]
ATGGCGTCTCGCGGCGTAAACAAAGTCATACTTGTCGGTCACCTTGGCCAGGATCCGGAAGTCCGTTACATGCCAAATGG
TGGTGCGGTTGCCACCCTGCCGCTTGCGACCTCCGAGACCTGGCGTGATAAACAATCCGGCGAACAGAAAGAAAAAACCG
AATGGCACCGTGTGGTGCTGTTTGGCAAACTCGCTGAAATTGCCGGCGAATACTTGCGTAAAGGTTCGCAGGTCTATATT
GAAGGCGCTTTGCGCACGCGTAAATGGGCAGATCAGAGCGGCCAGGATCGCTACACTACTGAGGTAGTCATTAACGTGGG
CGGCACGATGCAGATGCTGGGTGGTCGTAGTCAGACCGATAACCCGGGGCCCTCAGCGTCTGGTAGTTGGGGGCAACCTC
AGCAACCGACCCACAGTGGTACACCCCCTCAGGCGTCTGCCGGCAATGAACCGCCGATGGACTTTGATGATGACATCCCA
TTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

70.056

100

0.77

  ssb Glaesserella parasuis strain SC1401

52.486

100

0.59

  ssb Neisseria meningitidis MC58

43.503

100

0.478

  ssb Neisseria gonorrhoeae MS11

43.503

100

0.478