Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OM992_RS16170 Genome accession   NZ_CP110268
Coordinates   3129070..3129210 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus siamensis strain YB-1631     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3124070..3134210
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OM992_RS16145 (OM992_16145) - 3124366..3124749 (-) 384 WP_016938118.1 hotdog fold thioesterase -
  OM992_RS16150 (OM992_16150) comA 3124771..3125415 (-) 645 WP_049627264.1 response regulator transcription factor Regulator
  OM992_RS16155 (OM992_16155) comP 3125497..3127800 (-) 2304 WP_188154513.1 histidine kinase Regulator
  OM992_RS16160 (OM992_16160) comX 3127820..3127990 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  OM992_RS16165 (OM992_16165) comQ 3127953..3128939 (-) 987 WP_316936463.1 class 1 isoprenoid biosynthesis enzyme Regulator
  OM992_RS16170 (OM992_16170) degQ 3129070..3129210 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  OM992_RS16175 (OM992_16175) - 3129676..3130017 (+) 342 WP_049627267.1 hypothetical protein -
  OM992_RS16180 (OM992_16180) - 3130022..3131245 (-) 1224 WP_264819056.1 EAL and HDOD domain-containing protein -
  OM992_RS16185 (OM992_16185) - 3131375..3132841 (-) 1467 WP_095241408.1 nicotinate phosphoribosyltransferase -
  OM992_RS16190 (OM992_16190) - 3132859..3133410 (-) 552 WP_264819057.1 cysteine hydrolase family protein -
  OM992_RS16195 (OM992_16195) - 3133499..3133897 (-) 399 WP_016938110.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=753690 OM992_RS16170 WP_013353398.1 3129070..3129210(-) (degQ) [Bacillus siamensis strain YB-1631]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=753690 OM992_RS16170 WP_013353398.1 3129070..3129210(-) (degQ) [Bacillus siamensis strain YB-1631]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913