Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   OM992_RS16160 Genome accession   NZ_CP110268
Coordinates   3127820..3127990 (-) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus siamensis strain YB-1631     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3122820..3132990
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OM992_RS16130 (OM992_16130) - 3123208..3123684 (+) 477 WP_016938121.1 Na+/H+ antiporter subunit E -
  OM992_RS16135 (OM992_16135) - 3123684..3123968 (+) 285 WP_016938120.1 Na(+)/H(+) antiporter subunit F1 -
  OM992_RS16140 (OM992_16140) mnhG 3123952..3124326 (+) 375 WP_016938119.1 monovalent cation/H(+) antiporter subunit G -
  OM992_RS16145 (OM992_16145) - 3124366..3124749 (-) 384 WP_016938118.1 hotdog fold thioesterase -
  OM992_RS16150 (OM992_16150) comA 3124771..3125415 (-) 645 WP_049627264.1 response regulator transcription factor Regulator
  OM992_RS16155 (OM992_16155) comP 3125497..3127800 (-) 2304 WP_188154513.1 histidine kinase Regulator
  OM992_RS16160 (OM992_16160) comX 3127820..3127990 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  OM992_RS16165 (OM992_16165) comQ 3127953..3128939 (-) 987 WP_316936463.1 class 1 isoprenoid biosynthesis enzyme Regulator
  OM992_RS16170 (OM992_16170) degQ 3129070..3129210 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  OM992_RS16175 (OM992_16175) - 3129676..3130017 (+) 342 WP_049627267.1 hypothetical protein -
  OM992_RS16180 (OM992_16180) - 3130022..3131245 (-) 1224 WP_264819056.1 EAL and HDOD domain-containing protein -
  OM992_RS16185 (OM992_16185) - 3131375..3132841 (-) 1467 WP_095241408.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=753688 OM992_RS16160 WP_003152048.1 3127820..3127990(-) (comX) [Bacillus siamensis strain YB-1631]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=753688 OM992_RS16160 WP_003152048.1 3127820..3127990(-) (comX) [Bacillus siamensis strain YB-1631]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGATTCTATACAAACTCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA

Domains

Predicted by InterproScan.

Bacillus competence pheromone ComX (ComX)

(1-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5