Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   GOZ47_RS03985 Genome accession   NZ_AP021885
Coordinates   898821..899318 (-) Length   165 a.a.
NCBI ID   WP_048589852.1    Uniprot ID   -
Organism   Melissococcus plutonius strain DAT1033     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 875310..917039 898821..899318 within 0


Gene organization within MGE regions


Location: 875310..917039
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GOZ47_RS03800 (DAT1033_0770) - 875310..876290 (-) 981 WP_048589827.1 lytic exoenzyme target recognition domain-containing protein -
  GOZ47_RS03805 (DAT1033_0771) - 876316..876513 (-) 198 WP_048589828.1 phage holin -
  GOZ47_RS03810 (DAT1033_0772) - 876528..876734 (-) 207 WP_048589829.1 BhlA/UviB family holin-like peptide -
  GOZ47_RS03815 (DAT1033_0773) - 876773..876919 (-) 147 WP_048589830.1 XkdX family protein -
  GOZ47_RS03820 (DAT1033_0774) - 876909..877241 (-) 333 WP_048589831.1 hypothetical protein -
  GOZ47_RS03825 (DAT1033_0775) - 877256..877717 (-) 462 WP_048589832.1 hypothetical protein -
  GOZ47_RS03830 (DAT1033_0776) - 877717..878406 (-) 690 Protein_769 phage baseplate upper protein -
  GOZ47_RS03840 (DAT1033_0778) - 878396..878644 (-) 249 WP_048589833.1 hypothetical protein -
  GOZ47_RS03845 (DAT1033_0779) - 878628..878837 (-) 210 WP_048589834.1 hypothetical protein -
  GOZ47_RS03850 (DAT1033_0780) - 878824..880002 (-) 1179 WP_048589835.1 prophage endopeptidase tail family protein -
  GOZ47_RS03855 (DAT1033_0781) - 880015..880767 (-) 753 WP_160171416.1 phage tail domain-containing protein -
  GOZ47_RS03860 (DAT1033_0782) - 880851..882476 (-) 1626 WP_048589837.1 transglycosylase SLT domain-containing protein -
  GOZ47_RS03865 (DAT1033_0783) - 882499..885891 (-) 3393 WP_048593187.1 hypothetical protein -
  GOZ47_RS03870 (DAT1033_0784) - 885908..886108 (-) 201 WP_048589839.1 hypothetical protein -
  GOZ47_RS03875 (DAT1033_0785) - 886114..886443 (-) 330 WP_048589840.1 phage tail tube assembly chaperone -
  GOZ47_RS03880 (DAT1033_0786) - 886455..886742 (-) 288 WP_053078824.1 collagen-like protein -
  GOZ47_RS03885 (DAT1033_0787) - 886759..887379 (-) 621 WP_048589841.1 major tail protein -
  GOZ47_RS03890 (DAT1033_0788) - 887379..887765 (-) 387 WP_048589842.1 hypothetical protein -
  GOZ47_RS03895 (DAT1033_0789) - 887755..888183 (-) 429 WP_048589843.1 HK97-gp10 family putative phage morphogenesis protein -
  GOZ47_RS03900 (DAT1033_0790) - 888176..888511 (-) 336 WP_152666971.1 head-tail adaptor protein -
  GOZ47_RS03905 (DAT1033_0791) - 888480..888851 (-) 372 WP_064429784.1 head-tail connector protein -
  GOZ47_RS03910 (DAT1033_0792) - 888917..890074 (-) 1158 WP_053078825.1 phage major capsid protein -
  GOZ47_RS03915 (DAT1033_0793) - 890077..890613 (-) 537 WP_232040162.1 HK97 family phage prohead protease -
  GOZ47_RS03920 (DAT1033_0794) - 890576..891799 (-) 1224 WP_048589846.1 phage portal protein -
  GOZ47_RS03925 - 891802..892002 (-) 201 WP_048589847.1 hypothetical protein -
  GOZ47_RS03930 (DAT1033_0795) - 892003..893463 (-) 1461 WP_053078826.1 terminase TerL endonuclease subunit -
  GOZ47_RS03935 (DAT1033_0796) - 893509..893826 (-) 318 WP_053078827.1 hypothetical protein -
  GOZ47_RS03940 (DAT1033_0797) - 893823..894290 (-) 468 WP_048589848.1 phage terminase small subunit P27 family -
  GOZ47_RS03945 (DAT1033_0798) - 894343..894867 (-) 525 WP_160171417.1 HNH endonuclease -
  GOZ47_RS03950 (DAT1033_0799) - 894993..895166 (-) 174 WP_155522195.1 hypothetical protein -
  GOZ47_RS09340 - 895209..895439 (-) 231 WP_080719104.1 hypothetical protein -
  GOZ47_RS09820 - 895673..895759 (-) 87 WP_221293899.1 putative holin-like toxin -
  GOZ47_RS03955 (DAT1033_0801) - 895880..896569 (-) 690 WP_048589850.1 hypothetical protein -
  GOZ47_RS03960 (DAT1033_0802) - 896883..897302 (-) 420 WP_013774291.1 transcriptional regulator -
  GOZ47_RS03965 (DAT1033_0803) - 897316..897582 (-) 267 WP_013774292.1 hypothetical protein -
  GOZ47_RS03970 (DAT1033_0804) - 897572..897958 (-) 387 WP_013774293.1 hypothetical protein -
  GOZ47_RS03975 (DAT1033_0805) - 897959..898159 (-) 201 WP_013774294.1 hypothetical protein -
  GOZ47_RS03980 (DAT1033_0807) - 898386..898802 (-) 417 WP_048589851.1 RusA family crossover junction endodeoxyribonuclease -
  GOZ47_RS03985 (DAT1033_0808) ssb 898821..899318 (-) 498 WP_048589852.1 single-stranded DNA-binding protein Machinery gene
  GOZ47_RS03990 (DAT1033_0809) - 899315..899875 (-) 561 WP_048589853.1 hypothetical protein -
  GOZ47_RS03995 (DAT1033_0810) - 899893..900750 (-) 858 WP_048589854.1 phage replisome organizer N-terminal domain-containing protein -
  GOZ47_RS04000 (DAT1033_0811) - 900754..901440 (-) 687 WP_048589855.1 putative HNHc nuclease -
  GOZ47_RS04005 (DAT1033_0812) - 901430..902029 (-) 600 WP_232040164.1 ERF family protein -
  GOZ47_RS04010 (DAT1033_0813) - 902074..902544 (-) 471 WP_048589857.1 siphovirus Gp157 family protein -
  GOZ47_RS04015 (DAT1033_0814) - 902544..902849 (-) 306 WP_127515679.1 hypothetical protein -
  GOZ47_RS04020 (DAT1033_0815) - 902994..903437 (+) 444 WP_048589859.1 hypothetical protein -
  GOZ47_RS04025 - 903405..903638 (-) 234 WP_048589860.1 hypothetical protein -
  GOZ47_RS04030 (DAT1033_0816) - 903692..903832 (-) 141 WP_155522196.1 hypothetical protein -
  GOZ47_RS09185 (DAT1033_0817) - 903839..903976 (-) 138 WP_162836836.1 hypothetical protein -
  GOZ47_RS04035 (DAT1033_0818) - 904010..904285 (-) 276 WP_048589861.1 hypothetical protein -
  GOZ47_RS04040 (DAT1033_0819) - 904380..904883 (+) 504 WP_048589862.1 hypothetical protein -
  GOZ47_RS04045 (DAT1033_0820) - 905070..905594 (-) 525 WP_048589864.1 antA/AntB antirepressor family protein -
  GOZ47_RS04050 (DAT1033_0821) - 905675..906013 (+) 339 WP_048589865.1 hypothetical protein -
  GOZ47_RS04055 - 906003..906197 (-) 195 WP_048589866.1 hypothetical protein -
  GOZ47_RS04060 (DAT1033_0822) - 906332..906577 (-) 246 WP_048589867.1 hypothetical protein -
  GOZ47_RS04065 (DAT1033_0823) - 906589..907344 (-) 756 WP_048589868.1 phage antirepressor KilAC domain-containing protein -
  GOZ47_RS04070 (DAT1033_0824) - 907381..907599 (-) 219 WP_127515680.1 XRE family transcriptional regulator -
  GOZ47_RS04075 (DAT1033_0825) - 907771..908490 (+) 720 WP_232040180.1 helix-turn-helix domain-containing protein -
  GOZ47_RS04080 (DAT1033_0826) - 908595..909341 (+) 747 WP_048589870.1 hypothetical protein -
  GOZ47_RS04085 (DAT1033_0827) - 909431..909799 (-) 369 WP_064429785.1 Thoeris anti-defense Tad2 family protein -
  GOZ47_RS04090 (DAT1033_0828) - 909847..910596 (-) 750 WP_048589871.1 Rha family transcriptional regulator -
  GOZ47_RS09190 (DAT1033_0829) - 910620..910793 (-) 174 WP_162836837.1 hypothetical protein -
  GOZ47_RS04095 (DAT1033_0830) - 910984..911190 (-) 207 WP_048589872.1 helix-turn-helix transcriptional regulator -
  GOZ47_RS04100 (DAT1033_0831) - 911287..911769 (+) 483 WP_048589873.1 helix-turn-helix domain-containing protein -
  GOZ47_RS04105 (DAT1033_0832) - 911931..913076 (+) 1146 WP_048589874.1 tyrosine-type recombinase/integrase -
  GOZ47_RS04115 (DAT1033_0833) - 914367..914996 (-) 630 WP_013773992.1 putative bacteriocin export ABC transporter -
  GOZ47_RS04120 - 914999..915403 (-) 405 WP_041363481.1 DUF1430 domain-containing protein -
  GOZ47_RS04125 - 915400..916719 (-) 1320 WP_048589875.1 hypothetical protein -
  GOZ47_RS04130 (DAT1033_0835) - 916833..917039 (-) 207 WP_015694914.1 hypothetical protein -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 18907.78 Da        Isoelectric Point: 4.9814

>NTDB_id=75295 GOZ47_RS03985 WP_048589852.1 898821..899318(-) (ssb) [Melissococcus plutonius strain DAT1033]
MINNVVLVGRLTKDPDLRYTSGDSAVATFTLAVNRNFKNQNGDREADFVNCVIWRKPAETLANYACKGTLLGVVGRIQSR
SYENQQGQRVYVTEVVCDNFQLLESKNTRESQNKQDRDNLNKNESNYIQEQNNVFKTQNSEQLFNRNNNQSFGNQIDISD
DDLPF

Nucleotide


Download         Length: 498 bp        

>NTDB_id=75295 GOZ47_RS03985 WP_048589852.1 898821..899318(-) (ssb) [Melissococcus plutonius strain DAT1033]
ATGATAAACAATGTTGTATTGGTCGGCAGATTAACAAAGGATCCTGATTTACGCTATACATCTGGTGATTCAGCAGTAGC
AACTTTTACTTTAGCAGTCAATCGGAATTTCAAAAATCAAAACGGCGATCGAGAGGCTGATTTTGTTAATTGTGTTATTT
GGCGTAAACCAGCTGAAACATTAGCAAATTATGCTTGTAAGGGGACTTTGTTAGGTGTTGTAGGCAGAATTCAATCACGT
TCCTATGAAAATCAACAAGGACAACGTGTTTATGTGACTGAGGTTGTCTGCGATAATTTCCAACTGCTAGAAAGTAAAAA
TACACGTGAAAGCCAAAATAAGCAAGATAGAGACAATTTAAACAAAAACGAGAGTAATTATATCCAAGAGCAAAACAACG
TGTTTAAAACGCAAAATAGCGAGCAATTATTTAATCGTAATAATAATCAATCATTTGGTAACCAGATCGACATATCTGAC
GATGACCTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.234

100

0.624
  ssbA Bacillus subtilis subsp. subtilis str. 168

52.299

100

0.552
  ssbB Bacillus subtilis subsp. subtilis str. 168

63.208

64.242

0.406
  ssbB/cilA Streptococcus pneumoniae TIGR4

55.046

66.061

0.364

Multiple sequence alignment