Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NT398_RS14480 Genome accession   NZ_CP109933
Coordinates   2884724..2885194 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain SASWT1215     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2848805..2890893 2884724..2885194 within 0


Gene organization within MGE regions


Location: 2848805..2890893
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NT398_RS14240 (NT398_14245) groES 2848805..2849089 (+) 285 WP_000917289.1 co-chaperone GroES -
  NT398_RS14245 (NT398_14250) groL 2849165..2850781 (+) 1617 WP_000240642.1 chaperonin GroEL -
  NT398_RS14250 (NT398_14255) - 2850850..2852022 (-) 1173 WP_000179343.1 tyrosine-type recombinase/integrase -
  NT398_RS14255 (NT398_14260) - 2852036..2852710 (-) 675 WP_000620857.1 helix-turn-helix transcriptional regulator -
  NT398_RS14260 (NT398_14265) - 2852883..2853101 (+) 219 WP_000153640.1 helix-turn-helix transcriptional regulator -
  NT398_RS14265 (NT398_14270) - 2853106..2853423 (+) 318 WP_000481967.1 helix-turn-helix domain-containing protein -
  NT398_RS14270 (NT398_14275) - 2853420..2853566 (+) 147 WP_000784885.1 hypothetical protein -
  NT398_RS14275 (NT398_14280) - 2853583..2853768 (+) 186 WP_223200634.1 pathogenicity island protein -
  NT398_RS14280 (NT398_14285) - 2853771..2854097 (+) 327 WP_001078344.1 DUF1474 family protein -
  NT398_RS14285 (NT398_14290) - 2854162..2855031 (+) 870 WP_001002689.1 primase alpha helix C-terminal domain-containing protein -
  NT398_RS14290 (NT398_14295) - 2855045..2856754 (+) 1710 WP_000447473.1 DUF927 domain-containing protein -
  NT398_RS14295 (NT398_14300) - 2857064..2857444 (+) 381 WP_000356942.1 hypothetical protein -
  NT398_RS14300 (NT398_14305) - 2857441..2858082 (+) 642 WP_001047698.1 hypothetical protein -
  NT398_RS14305 (NT398_14310) - 2858532..2858873 (+) 342 WP_001190615.1 hypothetical protein -
  NT398_RS14310 (NT398_14315) - 2858885..2859463 (+) 579 WP_000846280.1 hypothetical protein -
  NT398_RS14315 (NT398_14320) - 2859481..2859699 (+) 219 WP_000448770.1 capsid morphogenesis B protein -
  NT398_RS14320 (NT398_14325) - 2859750..2860277 (+) 528 WP_000771368.1 spore coat protein -
  NT398_RS14325 (NT398_14330) - 2860280..2860621 (+) 342 WP_000358774.1 hypothetical protein -
  NT398_RS14330 (NT398_14335) - 2860618..2861187 (+) 570 WP_063653148.1 terminase small subunit -
  NT398_RS14335 (NT398_14340) tst 2861342..2862046 (-) 705 WP_001035599.1 toxic shock syndrome toxin TSST-1 -
  NT398_RS14340 (NT398_14345) - 2862925..2863485 (-) 561 WP_001035616.1 DUF4888 domain-containing protein -
  NT398_RS14345 (NT398_14350) sec3 2864273..2865073 (+) 801 WP_000278088.1 staphylococcal enterotoxin type C3 -
  NT398_RS14350 (NT398_14355) sel 2865242..2865964 (-) 723 WP_000746599.1 staphylococcal enterotoxin type L -
  NT398_RS14355 (NT398_14360) - 2866981..2868288 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  NT398_RS14360 (NT398_14365) - 2868732..2869955 (-) 1224 WP_000206625.1 ArgE/DapE family deacylase -
  NT398_RS14365 (NT398_14370) lukH 2870391..2871446 (+) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  NT398_RS14370 (NT398_14375) lukG 2871468..2872484 (+) 1017 WP_000595392.1 bi-component leukocidin LukGH subunit G -
  NT398_RS14375 (NT398_14380) sph 2872722..2873552 (-) 831 Protein_2800 sphingomyelin phosphodiesterase -
  NT398_RS14380 (NT398_14385) - 2873603..2874640 (-) 1038 WP_000857198.1 site-specific integrase -
  NT398_RS14385 (NT398_14390) - 2874813..2875352 (-) 540 WP_000391618.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NT398_RS14390 (NT398_14395) - 2875492..2875659 (-) 168 WP_000705238.1 hypothetical protein -
  NT398_RS14395 (NT398_14400) - 2875859..2876044 (-) 186 WP_001089804.1 hypothetical protein -
  NT398_RS14400 (NT398_14405) - 2876031..2876186 (-) 156 WP_001049399.1 hypothetical protein -
  NT398_RS14405 (NT398_14410) - 2876198..2876905 (-) 708 WP_000094093.1 XRE family transcriptional regulator -
  NT398_RS14410 (NT398_14415) - 2877076..2877315 (+) 240 WP_000548578.1 helix-turn-helix transcriptional regulator -
  NT398_RS14415 (NT398_14420) - 2877328..2877588 (+) 261 WP_000435341.1 transcriptional regulator -
  NT398_RS14420 (NT398_14425) - 2877612..2878151 (-) 540 WP_000351243.1 hypothetical protein -
  NT398_RS14425 (NT398_14430) - 2878208..2878960 (+) 753 WP_001148618.1 phage antirepressor KilAC domain-containing protein -
  NT398_RS14430 (NT398_14435) - 2878977..2879171 (+) 195 WP_000388066.1 hypothetical protein -
  NT398_RS14435 (NT398_14440) - 2879202..2879342 (+) 141 WP_000939496.1 hypothetical protein -
  NT398_RS14440 (NT398_14445) - 2879357..2879989 (-) 633 WP_000275058.1 hypothetical protein -
  NT398_RS14445 (NT398_14450) - 2880048..2880368 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  NT398_RS14450 (NT398_14455) - 2880365..2880526 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  NT398_RS14455 (NT398_14460) - 2880619..2880879 (+) 261 WP_000291489.1 DUF1108 family protein -
  NT398_RS14460 (NT398_14465) - 2880888..2881151 (+) 264 WP_001205732.1 hypothetical protein -
  NT398_RS14465 (NT398_14470) - 2881160..2883103 (+) 1944 WP_000700547.1 ATP-binding protein -
  NT398_RS14470 (NT398_14475) - 2883105..2884025 (+) 921 WP_000138475.1 recombinase RecT -
  NT398_RS14475 (NT398_14480) - 2884106..2884723 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  NT398_RS14480 (NT398_14485) ssbA 2884724..2885194 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  NT398_RS14485 (NT398_14490) - 2885224..2886108 (+) 885 WP_000148301.1 DnaD domain protein -
  NT398_RS14490 (NT398_14495) - 2886115..2886333 (+) 219 WP_000338528.1 hypothetical protein -
  NT398_RS14495 (NT398_14500) - 2886342..2886746 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  NT398_RS14500 (NT398_14505) - 2886759..2887127 (+) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  NT398_RS14505 (NT398_14510) - 2887131..2887373 (+) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  NT398_RS14510 (NT398_14515) - 2887438..2887887 (+) 450 WP_000982711.1 YopX family protein -
  NT398_RS14515 (NT398_14520) - 2887884..2888393 (+) 510 WP_001105598.1 hypothetical protein -
  NT398_RS14520 (NT398_14525) - 2888390..2888800 (+) 411 WP_138273640.1 acetyltransferase -
  NT398_RS14525 (NT398_14530) - 2888793..2889329 (+) 537 WP_001066444.1 dUTPase -
  NT398_RS14530 (NT398_14535) - 2889366..2889572 (+) 207 WP_000195820.1 DUF1381 domain-containing protein -
  NT398_RS14535 (NT398_14540) - 2889569..2889718 (+) 150 WP_000595265.1 transcriptional activator RinB -
  NT398_RS14540 (NT398_14545) - 2889718..2889918 (+) 201 WP_000265039.1 DUF1514 family protein -
  NT398_RS14545 (NT398_14550) - 2889946..2890362 (+) 417 WP_000590126.1 hypothetical protein -
  NT398_RS14550 (NT398_14555) - 2890594..2890893 (+) 300 WP_000988336.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=750844 NT398_RS14480 WP_000934770.1 2884724..2885194(+) (ssbA) [Staphylococcus aureus strain SASWT1215]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=750844 NT398_RS14480 WP_000934770.1 2884724..2885194(+) (ssbA) [Staphylococcus aureus strain SASWT1215]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365