Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   NT398_RS05885 Genome accession   NZ_CP109933
Coordinates   1175789..1176259 (-) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain SASWT1215     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1142668..1188824 1175789..1176259 within 0


Gene organization within MGE regions


Location: 1142668..1188824
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NT398_RS05660 (NT398_05665) - 1142668..1143708 (-) 1041 WP_000582326.1 CNNM domain-containing protein -
  NT398_RS05665 (NT398_05670) - 1144073..1144387 (+) 315 WP_000274029.1 hypothetical protein -
  NT398_RS05670 (NT398_05675) - 1144393..1144532 (-) 140 Protein_1092 hypothetical protein -
  NT398_RS05675 (NT398_05680) - 1145267..1146712 (-) 1446 WP_001148136.1 SH3 domain-containing protein -
  NT398_RS05680 (NT398_05685) - 1146693..1147130 (-) 438 WP_000354132.1 phage holin -
  NT398_RS05685 (NT398_05690) - 1147186..1147581 (-) 396 WP_217658510.1 hypothetical protein -
  NT398_RS05690 (NT398_05695) - 1147587..1148759 (-) 1173 WP_217658509.1 BppU family phage baseplate upper protein -
  NT398_RS05695 (NT398_05700) - 1148772..1150646 (-) 1875 WP_217659177.1 glucosaminidase domain-containing protein -
  NT398_RS05700 (NT398_05705) - 1150780..1151079 (-) 300 WP_053868929.1 DUF2951 domain-containing protein -
  NT398_RS05705 (NT398_05710) - 1151120..1151293 (-) 174 WP_001790193.1 XkdX family protein -
  NT398_RS05710 (NT398_05715) - 1151297..1151674 (-) 378 WP_217658889.1 DUF2977 domain-containing protein -
  NT398_RS05715 (NT398_05720) - 1151674..1153497 (-) 1824 WP_217659176.1 BppU family phage baseplate upper protein -
  NT398_RS05720 (NT398_05725) - 1153497..1155395 (-) 1899 WP_217658887.1 hypothetical protein -
  NT398_RS05725 (NT398_05730) - 1155408..1157294 (-) 1887 WP_217658507.1 SGNH/GDSL hydrolase family protein -
  NT398_RS05730 (NT398_05735) - 1157305..1158240 (-) 936 WP_031897669.1 phage tail domain-containing protein -
  NT398_RS05735 (NT398_05740) - 1158255..1161224 (-) 2970 WP_217659175.1 terminase -
  NT398_RS05740 (NT398_05745) - 1161227..1161568 (-) 342 WP_001580347.1 hypothetical protein -
  NT398_RS05745 (NT398_05750) - 1161589..1162083 (-) 495 WP_000141082.1 tail assembly chaperone -
  NT398_RS05750 (NT398_05755) - 1162145..1162705 (-) 561 WP_000046067.1 hypothetical protein -
  NT398_RS05755 (NT398_05760) - 1162692..1163129 (-) 438 WP_000270196.1 DUF3168 domain-containing protein -
  NT398_RS05760 (NT398_05765) - 1163142..1163555 (-) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  NT398_RS05765 (NT398_05770) - 1163542..1163877 (-) 336 WP_000482986.1 phage head closure protein -
  NT398_RS05770 (NT398_05775) - 1163870..1164184 (-) 315 WP_000338936.1 phage head-tail connector protein -
  NT398_RS05775 (NT398_05780) - 1164184..1164510 (-) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  NT398_RS05780 (NT398_05785) - 1164527..1165351 (-) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  NT398_RS05785 (NT398_05790) - 1165372..1165968 (-) 597 WP_000366932.1 phage scaffolding protein -
  NT398_RS05790 (NT398_05795) - 1166066..1167046 (-) 981 WP_049886845.1 phage head morphogenesis protein -
  NT398_RS05795 (NT398_05800) - 1166985..1168463 (-) 1479 WP_049886846.1 phage portal protein -
  NT398_RS05800 (NT398_05805) - 1168417..1169625 (-) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  NT398_RS05805 (NT398_05810) - 1169618..1170112 (-) 495 WP_029550565.1 terminase small subunit -
  NT398_RS05810 (NT398_05815) - 1170463..1170864 (-) 402 WP_217658505.1 hypothetical protein -
  NT398_RS05815 (NT398_05820) - 1170976..1171080 (-) 105 Protein_1121 hypothetical protein -
  NT398_RS05820 (NT398_05825) - 1171077..1171283 (-) 207 WP_000195810.1 DUF1381 domain-containing protein -
  NT398_RS05825 (NT398_05830) - 1171320..1171856 (-) 537 WP_217658503.1 dUTP diphosphatase -
  NT398_RS05830 (NT398_05835) - 1171853..1172098 (-) 246 WP_217658511.1 DUF1024 family protein -
  NT398_RS05835 (NT398_05840) - 1172091..1172398 (-) 308 Protein_1125 hypothetical protein -
  NT398_RS05840 (NT398_05845) - 1172395..1172742 (-) 348 WP_000979209.1 YopX family protein -
  NT398_RS05845 (NT398_05850) - 1172739..1173119 (-) 381 WP_001668982.1 hypothetical protein -
  NT398_RS05850 (NT398_05855) - 1173122..1173328 (-) 207 WP_000693989.1 hypothetical protein -
  NT398_RS05855 (NT398_05860) - 1173342..1173590 (-) 249 WP_000178987.1 SAV1978 family virulence-associated passenger protein -
  NT398_RS05860 (NT398_05865) - 1173587..1173844 (-) 258 WP_000111491.1 DUF3310 domain-containing protein -
  NT398_RS05865 (NT398_05870) - 1173844..1174215 (-) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  NT398_RS05870 (NT398_05875) - 1174228..1174632 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  NT398_RS05875 (NT398_05880) - 1174641..1174859 (-) 219 WP_000338528.1 hypothetical protein -
  NT398_RS05880 (NT398_05885) - 1174866..1175759 (-) 894 WP_000148333.1 DnaD domain-containing protein -
  NT398_RS05885 (NT398_05890) ssbA 1175789..1176259 (-) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  NT398_RS05890 (NT398_05895) - 1176260..1176877 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  NT398_RS05895 (NT398_05900) - 1176958..1177878 (-) 921 WP_000138475.1 recombinase RecT -
  NT398_RS05900 (NT398_05905) - 1177880..1179823 (-) 1944 WP_000700565.1 AAA family ATPase -
  NT398_RS05905 (NT398_05910) - 1179832..1180095 (-) 264 WP_001205732.1 hypothetical protein -
  NT398_RS05910 (NT398_05915) - 1180104..1180364 (-) 261 WP_000291510.1 DUF1108 family protein -
  NT398_RS05915 (NT398_05920) - 1180369..1180671 (-) 303 WP_000165371.1 DUF2482 family protein -
  NT398_RS05920 (NT398_05925) - 1180766..1180927 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  NT398_RS05925 (NT398_05930) - 1180920..1181141 (-) 222 WP_000594788.1 hypothetical protein -
  NT398_RS05930 (NT398_05935) - 1181212..1181877 (+) 666 WP_001807461.1 hypothetical protein -
  NT398_RS05935 (NT398_05940) - 1181898..1181966 (-) 69 Protein_1145 hypothetical protein -
  NT398_RS05940 (NT398_05945) - 1181963..1182724 (-) 762 WP_217658518.1 phage antirepressor KilAC domain-containing protein -
  NT398_RS05945 (NT398_05950) - 1182726..1182911 (-) 186 WP_000933363.1 helix-turn-helix transcriptional regulator -
  NT398_RS05950 (NT398_05955) - 1183351..1183560 (+) 210 WP_000642492.1 hypothetical protein -
  NT398_RS05955 (NT398_05960) - 1183550..1183693 (-) 144 WP_000939498.1 hypothetical protein -
  NT398_RS05960 (NT398_05965) - 1183708..1184151 (-) 444 WP_023487065.1 hypothetical protein -
  NT398_RS05965 (NT398_05970) - 1184164..1184412 (-) 249 WP_000272859.1 helix-turn-helix transcriptional regulator -
  NT398_RS05970 (NT398_05975) - 1184576..1184899 (+) 324 WP_001260487.1 helix-turn-helix transcriptional regulator -
  NT398_RS05975 (NT398_05980) - 1184912..1185376 (+) 465 WP_031767738.1 toxin -
  NT398_RS05980 (NT398_05985) - 1185408..1186112 (+) 705 WP_000440838.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NT398_RS05985 (NT398_05990) - 1186310..1187359 (+) 1050 WP_217659178.1 tyrosine-type recombinase/integrase -
  NT398_RS05990 (NT398_05995) sufB 1187427..1188824 (-) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=750827 NT398_RS05885 WP_000934759.1 1175789..1176259(-) (ssbA) [Staphylococcus aureus strain SASWT1215]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=750827 NT398_RS05885 WP_000934759.1 1175789..1176259(-) (ssbA) [Staphylococcus aureus strain SASWT1215]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635
  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365