Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   OK117_RS09595 Genome accession   NZ_CP109886
Coordinates   2070771..2071217 (+) Length   148 a.a.
NCBI ID   WP_058564846.1    Uniprot ID   A0AAJ5QZ32
Organism   Xylella fastidiosa subsp. fastidiosa strain CFBP8073     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2031440..2076270 2070771..2071217 within 0


Gene organization within MGE regions


Location: 2031440..2076270
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OK117_RS09320 (OK117_09335) - 2031494..2032567 (+) 1074 WP_058564469.1 site-specific integrase -
  OK117_RS09325 (OK117_09340) - 2032890..2033177 (+) 288 WP_004083921.1 BrnT family toxin -
  OK117_RS09330 (OK117_09345) - 2033161..2033454 (+) 294 WP_234759377.1 BrnA antitoxin family protein -
  OK117_RS09335 (OK117_09350) - 2033566..2033763 (-) 198 WP_058565181.1 hypothetical protein -
  OK117_RS09340 (OK117_09355) - 2034019..2034810 (-) 792 WP_040123228.1 DNA adenine methylase -
  OK117_RS09345 (OK117_09360) - 2034877..2035083 (+) 207 WP_272141947.1 hypothetical protein -
  OK117_RS09350 (OK117_09365) - 2035046..2035741 (-) 696 WP_272141949.1 hypothetical protein -
  OK117_RS09355 (OK117_09370) - 2035816..2036235 (-) 420 WP_272141951.1 hypothetical protein -
  OK117_RS09360 (OK117_09375) - 2036239..2036751 (-) 513 WP_004087261.1 hypothetical protein -
  OK117_RS09365 (OK117_09380) - 2036744..2039569 (-) 2826 WP_272141953.1 phage tail protein -
  OK117_RS09370 (OK117_09385) - 2039559..2039795 (-) 237 WP_057683576.1 hypothetical protein -
  OK117_RS09375 (OK117_09390) - 2039792..2040220 (-) 429 WP_004086822.1 hypothetical protein -
  OK117_RS09380 (OK117_09395) - 2040211..2041653 (-) 1443 WP_058565043.1 DUF2163 domain-containing protein -
  OK117_RS09385 (OK117_09400) - 2041643..2042830 (-) 1188 WP_057683693.1 hypothetical protein -
  OK117_RS09390 (OK117_09405) - 2042823..2045336 (-) 2514 WP_058565042.1 hypothetical protein -
  OK117_RS09395 (OK117_09410) - 2045337..2045504 (-) 168 WP_004086814.1 hypothetical protein -
  OK117_RS09400 (OK117_09415) - 2045501..2045947 (-) 447 WP_058565041.1 DUF6631 family protein -
  OK117_RS09405 (OK117_09420) - 2045944..2046693 (-) 750 WP_057683696.1 hypothetical protein -
  OK117_RS09410 (OK117_09425) - 2046690..2047163 (-) 474 WP_057683697.1 hypothetical protein -
  OK117_RS09415 (OK117_09430) - 2047160..2047480 (-) 321 WP_004086810.1 hypothetical protein -
  OK117_RS09420 (OK117_09435) - 2047477..2048262 (-) 786 WP_057683698.1 hypothetical protein -
  OK117_RS09425 (OK117_09440) - 2048383..2048784 (-) 402 WP_233341831.1 hypothetical protein -
  OK117_RS09430 (OK117_09445) - 2048784..2049287 (-) 504 WP_233337731.1 lysozyme -
  OK117_RS09435 (OK117_09450) - 2049280..2049504 (-) 225 WP_081046874.1 hypothetical protein -
  OK117_RS09440 (OK117_09455) - 2049576..2049935 (-) 360 WP_057683700.1 DUF2190 family protein -
  OK117_RS09445 (OK117_09460) - 2050008..2052323 (-) 2316 WP_272141960.1 ClpP-like prohead protease/major capsid protein fusion protein -
  OK117_RS09450 (OK117_09465) - 2052320..2053882 (-) 1563 WP_272141962.1 phage portal protein -
  OK117_RS09455 (OK117_09470) - 2053879..2054115 (-) 237 WP_004088842.1 hypothetical protein -
  OK117_RS09460 (OK117_09475) - 2054192..2056291 (-) 2100 WP_272141964.1 phage terminase large subunit family protein -
  OK117_RS09465 (OK117_09480) - 2056288..2056896 (-) 609 WP_306308957.1 hypothetical protein -
  OK117_RS09470 (OK117_09485) - 2057283..2058788 (-) 1506 WP_272141969.1 VapE domain-containing protein -
  OK117_RS09475 (OK117_09490) - 2058785..2059840 (-) 1056 WP_272141971.1 DNA primase -
  OK117_RS09480 (OK117_09495) - 2059839..2060240 (+) 402 WP_272141973.1 hypothetical protein -
  OK117_RS09485 (OK117_09500) - 2060342..2060965 (-) 624 WP_272141976.1 hypothetical protein -
  OK117_RS09490 (OK117_09505) - 2061023..2061373 (-) 351 WP_272141978.1 hypothetical protein -
  OK117_RS09495 (OK117_09510) - 2061360..2061605 (-) 246 WP_071869972.1 YdaS family helix-turn-helix protein -
  OK117_RS09500 (OK117_09515) - 2061669..2062709 (+) 1041 WP_272141982.1 XRE family transcriptional regulator -
  OK117_RS09505 (OK117_09520) - 2062881..2063180 (+) 300 WP_128723870.1 hypothetical protein -
  OK117_RS09510 (OK117_09525) - 2063305..2063583 (+) 279 WP_233341916.1 hypothetical protein -
  OK117_RS09515 (OK117_09530) - 2063857..2064156 (+) 300 WP_128723870.1 hypothetical protein -
  OK117_RS09520 (OK117_09535) - 2064198..2064455 (+) 258 WP_081046906.1 hypothetical protein -
  OK117_RS09525 (OK117_09540) - 2064452..2064859 (+) 408 WP_233341877.1 hypothetical protein -
  OK117_RS09530 (OK117_09545) - 2064871..2065137 (+) 267 WP_233341876.1 hypothetical protein -
  OK117_RS09535 (OK117_09550) - 2065134..2065868 (+) 735 WP_272141998.1 Bro-N domain-containing protein -
  OK117_RS09540 (OK117_09555) - 2065989..2066197 (+) 209 Protein_1864 hypothetical protein -
  OK117_RS09545 (OK117_09560) - 2066875..2067339 (+) 465 WP_058565212.1 DUF1566 domain-containing protein -
  OK117_RS09550 (OK117_09565) - 2067336..2067785 (+) 450 WP_128735287.1 hypothetical protein -
  OK117_RS09555 (OK117_09570) - 2067782..2068003 (+) 222 WP_021358638.1 hypothetical protein -
  OK117_RS09560 (OK117_09575) - 2068000..2068278 (+) 279 WP_057682790.1 hypothetical protein -
  OK117_RS09565 (OK117_09580) - 2068275..2068541 (+) 267 WP_058565192.1 hypothetical protein -
  OK117_RS09570 (OK117_09585) - 2068534..2068695 (+) 162 WP_196242788.1 hypothetical protein -
  OK117_RS09575 (OK117_09590) - 2068673..2069206 (+) 534 WP_272142002.1 pilin -
  OK117_RS09580 (OK117_09595) - 2069299..2070054 (+) 756 WP_272142004.1 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase -
  OK117_RS09585 (OK117_09600) - 2070051..2070581 (+) 531 WP_272142006.1 hypothetical protein -
  OK117_RS09590 (OK117_09605) - 2070581..2070787 (+) 207 WP_233337694.1 hypothetical protein -
  OK117_RS09595 (OK117_09610) ssb 2070771..2071217 (+) 447 WP_058564846.1 single-stranded DNA-binding protein Machinery gene
  OK117_RS09600 (OK117_09615) - 2071236..2071562 (+) 327 WP_024749194.1 pyocin activator PrtN family protein -
  OK117_RS09605 (OK117_09620) - 2072617..2072769 (-) 153 WP_155115079.1 hypothetical protein -
  OK117_RS09610 (OK117_09625) - 2073337..2075382 (-) 2046 WP_038227902.1 TonB-dependent receptor -
  OK117_RS09615 (OK117_09630) - 2075542..2075952 (+) 411 WP_004089891.1 MerC domain-containing protein -
  OK117_RS09620 (OK117_09635) - 2076088..2076270 (+) 183 WP_004086643.1 30S ribosomal protein THX -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16634.53 Da        Isoelectric Point: 7.3545

>NTDB_id=750388 OK117_RS09595 WP_058564846.1 2070771..2071217(+) (ssb) [Xylella fastidiosa subsp. fastidiosa strain CFBP8073]
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRRPAKVRNNDKAYAYAGDDFHDDDIPF

Nucleotide


Download         Length: 447 bp        

>NTDB_id=750388 OK117_RS09595 WP_058564846.1 2070771..2071217(+) (ssb) [Xylella fastidiosa subsp. fastidiosa strain CFBP8073]
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGTAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGCGAAGGCTCCAGCGGCATCACACCACAGCGGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

41.477

100

0.493

  ssb Neisseria meningitidis MC58

38.728

100

0.453

  ssb Neisseria gonorrhoeae MS11

38.728

100

0.453

  ssb Glaesserella parasuis strain SC1401

42.029

93.243

0.392