Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   NTP67_RS03585 Genome accession   NZ_CP109846
Coordinates   836503..836961 (-) Length   152 a.a.
NCBI ID   WP_264403434.1    Uniprot ID   -
Organism   Providencia rettgeri strain 12105 isolate P12105     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 831252..871054 836503..836961 within 0


Gene organization within MGE regions


Location: 831252..871054
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NTP67_RS22030 (NTP67_03540) - 831252..832298 (-) 1047 WP_264403426.1 site-specific integrase -
  NTP67_RS22035 (NTP67_03545) - 832214..832510 (-) 297 WP_264403427.1 helix-turn-helix domain-containing protein -
  NTP67_RS03550 (NTP67_03550) - 832503..832739 (-) 237 WP_264403428.1 hypothetical protein -
  NTP67_RS03555 (NTP67_03555) - 832762..833292 (-) 531 WP_264403429.1 phage N-6-adenine-methyltransferase -
  NTP67_RS03560 (NTP67_03560) - 833282..833599 (-) 318 WP_264403430.1 DUF2591 domain-containing protein -
  NTP67_RS03565 (NTP67_03565) - 833592..833780 (-) 189 WP_264403431.1 hypothetical protein -
  NTP67_RS03570 (NTP67_03570) - 834778..835533 (-) 756 WP_264403432.1 hypothetical protein -
  NTP67_RS03575 (NTP67_03575) - 835582..835869 (-) 288 WP_264403433.1 hypothetical protein -
  NTP67_RS03580 (NTP67_03580) - 835936..836490 (-) 555 WP_052170000.1 hypothetical protein -
  NTP67_RS03585 (NTP67_03585) ssb 836503..836961 (-) 459 WP_264403434.1 single-stranded DNA-binding protein Machinery gene
  NTP67_RS03590 (NTP67_03590) - 836962..837576 (-) 615 WP_264403435.1 ERF family protein -
  NTP67_RS03595 (NTP67_03595) - 837592..837969 (-) 378 WP_264403436.1 hypothetical protein -
  NTP67_RS03600 (NTP67_03600) - 837962..838114 (-) 153 WP_180312428.1 hypothetical protein -
  NTP67_RS22040 (NTP67_03605) - 838111..838311 (-) 201 WP_166686015.1 hypothetical protein -
  NTP67_RS03610 (NTP67_03610) - 838536..839498 (-) 963 WP_264403437.1 cell envelope biogenesis protein TolA -
  NTP67_RS22045 (NTP67_03615) - 839563..839826 (-) 264 WP_264403438.1 hypothetical protein -
  NTP67_RS22050 (NTP67_03620) - 839830..840021 (-) 192 WP_264403439.1 hypothetical protein -
  NTP67_RS03625 (NTP67_03625) - 840051..840227 (-) 177 WP_239978580.1 hypothetical protein -
  NTP67_RS03630 (NTP67_03630) - 840286..840540 (-) 255 WP_264403440.1 hypothetical protein -
  NTP67_RS03635 (NTP67_03635) - 840550..840825 (-) 276 WP_264403441.1 hypothetical protein -
  NTP67_RS03645 (NTP67_03645) - 841281..841928 (-) 648 WP_264403442.1 S24 family peptidase -
  NTP67_RS03650 (NTP67_03650) - 842009..842194 (+) 186 WP_153673589.1 Cro/CI family transcriptional regulator -
  NTP67_RS03655 (NTP67_03655) - 842303..842575 (+) 273 WP_244061640.1 CII family transcriptional regulator -
  NTP67_RS03660 (NTP67_03660) - 842604..842771 (+) 168 WP_226693937.1 hypothetical protein -
  NTP67_RS03665 (NTP67_03665) - 842764..843597 (+) 834 WP_264403444.1 replication protein -
  NTP67_RS03670 (NTP67_03670) - 843597..844967 (+) 1371 WP_264403445.1 replicative DNA helicase -
  NTP67_RS22055 (NTP67_03675) - 845175..845558 (+) 384 WP_264403446.1 DUF551 domain-containing protein -
  NTP67_RS22060 (NTP67_03680) - 845558..845734 (+) 177 WP_264403447.1 Lar family restriction alleviation protein -
  NTP67_RS22065 (NTP67_03685) - 845724..845981 (+) 258 WP_239978600.1 hypothetical protein -
  NTP67_RS03690 (NTP67_03690) - 845974..846225 (+) 252 WP_166686000.1 DUF4752 family protein -
  NTP67_RS03695 (NTP67_03695) - 846235..846678 (+) 444 WP_264403450.1 YbcN family protein -
  NTP67_RS03700 (NTP67_03700) - 846905..847363 (+) 459 WP_264403451.1 hypothetical protein -
  NTP67_RS22070 (NTP67_03705) - 847363..847575 (+) 213 WP_240133261.1 hypothetical protein -
  NTP67_RS03710 (NTP67_03710) - 847572..848354 (+) 783 WP_264403453.1 antitermination protein -
  NTP67_RS03715 (NTP67_03715) - 848809..849222 (+) 414 WP_071548375.1 putative holin -
  NTP67_RS22075 (NTP67_03720) - 849219..849497 (+) 279 WP_071548373.1 hypothetical protein -
  NTP67_RS03725 (NTP67_03725) - 849484..849966 (+) 483 WP_071548371.1 TIGR02594 family protein -
  NTP67_RS03730 (NTP67_03730) - 849968..850417 (+) 450 WP_071548369.1 lysis protein -
  NTP67_RS03735 (NTP67_03735) - 850644..851012 (+) 369 WP_071548367.1 Gp49 family protein -
  NTP67_RS03740 (NTP67_03740) - 851130..851357 (+) 228 WP_071548364.1 DUF2560 family protein -
  NTP67_RS03745 (NTP67_03745) - 851444..851641 (+) 198 WP_071548362.1 hypothetical protein -
  NTP67_RS22080 (NTP67_03750) - 851725..852213 (+) 489 WP_071548360.1 terminase small subunit -
  NTP67_RS03755 (NTP67_03755) - 852194..853636 (+) 1443 WP_071548358.1 terminase family protein -
  NTP67_RS03760 (NTP67_03760) - 853639..855729 (+) 2091 WP_264403458.1 portal protein -
  NTP67_RS03765 (NTP67_03765) - 855744..856658 (+) 915 WP_071548355.1 scaffolding protein -
  NTP67_RS03770 (NTP67_03770) - 856658..857941 (+) 1284 WP_071548353.1 P22 phage major capsid protein family protein -
  NTP67_RS03775 (NTP67_03775) - 857996..858205 (+) 210 WP_071548352.1 hypothetical protein -
  NTP67_RS03780 (NTP67_03780) - 858183..858680 (+) 498 WP_071548351.1 packaged DNA stabilization gp4 family protein -
  NTP67_RS22085 - 858652..860445 (+) 1794 WP_336432861.1 packaged DNA stabilization protein -
  NTP67_RS03795 (NTP67_03795) - 860473..861015 (+) 543 WP_264403462.1 NUMOD4 domain-containing protein -
  NTP67_RS03800 (NTP67_03800) - 861008..861727 (+) 720 WP_264403464.1 phage tail protein -
  NTP67_RS03805 (NTP67_03805) - 861735..862193 (+) 459 WP_264403465.1 DUF2824 family protein -
  NTP67_RS03810 (NTP67_03810) - 862196..862891 (+) 696 WP_264403467.1 DNA transfer protein -
  NTP67_RS03815 (NTP67_03815) - 862891..863682 (+) 792 WP_264403468.1 DNA transfer protein -
  NTP67_RS03825 (NTP67_03825) - 864912..865619 (+) 708 WP_264403470.1 hypothetical protein -
  NTP67_RS03830 (NTP67_03830) - 865631..867595 (+) 1965 WP_264403472.1 hypothetical protein -
  NTP67_RS03835 (NTP67_03835) - 867592..867999 (-) 408 WP_164561100.1 hypothetical protein -
  NTP67_RS22090 (NTP67_03840) - 868073..868444 (+) 372 WP_264403475.1 hypothetical protein -
  NTP67_RS03845 (NTP67_03845) - 868449..868628 (-) 180 WP_210845317.1 hypothetical protein -
  NTP67_RS03850 (NTP67_03850) - 868715..868969 (-) 255 WP_264403478.1 Arc family DNA-binding protein -
  NTP67_RS03855 (NTP67_03855) - 869084..871054 (+) 1971 WP_264403479.1 phage head-binding domain-containing protein -

Sequence

Protein


Download         Length: 152 a.a.        Molecular weight: 16839.94 Da        Isoelectric Point: 7.2025

>NTDB_id=750050 NTP67_RS03585 WP_264403434.1 836503..836961(-) (ssb) [Providencia rettgeri strain 12105 isolate P12105]
MASKGVNKVILIGHLGQDPEIRYMPNGGAVASLTLATSESWRDKQSGEMREKTEWHRVVIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNVGGSMQMLGGNGGNNQTGSQNLRKPLQQQKAPQNEPPMNFDDDMIPF

Nucleotide


Download         Length: 459 bp        

>NTDB_id=750050 NTP67_RS03585 WP_264403434.1 836503..836961(-) (ssb) [Providencia rettgeri strain 12105 isolate P12105]
ATGGCAAGTAAAGGTGTAAACAAAGTAATTCTCATTGGTCACTTAGGCCAAGACCCTGAAATACGCTACATGCCTAATGG
TGGCGCAGTAGCAAGTCTAACACTAGCCACATCAGAATCATGGCGTGACAAACAATCGGGTGAAATGCGCGAGAAAACTG
AGTGGCATAGAGTGGTGATTTTCGGAAAGTTAGCTGAAGTTGCAGGTGAATACCTGAAAAAAGGCTCACAAGTCTATATC
GAAGGTTCTCTGCAAACCCGTAAATGGCAAGACCAAAGCGGTCAAGATAGATACACAACAGAAGTCGTTGTGAATGTCGG
CGGCTCTATGCAGATGTTAGGCGGTAACGGTGGCAATAATCAGACAGGAAGCCAGAACTTGCGAAAACCTCTGCAGCAGC
AAAAAGCACCACAGAACGAGCCACCGATGAATTTCGATGACGATATGATCCCGTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

64.246

100

0.757
  ssb Glaesserella parasuis strain SC1401

52.747

100

0.632
  ssb Neisseria gonorrhoeae MS11

42.045

100

0.487
  ssb Neisseria meningitidis MC58

45.205

96.053

0.434