Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   OI909_RS12565 Genome accession   NZ_CP109694
Coordinates   2529255..2529704 (+) Length   149 a.a.
NCBI ID   WP_284592724.1    Uniprot ID   -
Organism   Enterobacter asburiae strain 2017-45-54-05     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2492016..2536070 2529255..2529704 within 0


Gene organization within MGE regions


Location: 2492016..2536070
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OI909_RS12290 (OI909_12285) - 2492016..2492432 (-) 417 WP_284592692.1 tail fiber assembly protein -
  OI909_RS12295 (OI909_12290) - 2492435..2493241 (-) 807 WP_284592693.1 hypothetical protein -
  OI909_RS12300 (OI909_12295) - 2493568..2494272 (-) 705 WP_284592694.1 hypothetical protein -
  OI909_RS12305 (OI909_12300) - 2494274..2495692 (-) 1419 WP_284592695.1 ubiquitin-activating E1 FCCH domain-containing protein -
  OI909_RS12310 (OI909_12305) - 2495689..2496021 (-) 333 WP_284592696.1 hypothetical protein -
  OI909_RS12315 (OI909_12310) - 2496018..2496734 (-) 717 WP_284592697.1 hypothetical protein -
  OI909_RS12320 (OI909_12315) - 2496731..2497750 (-) 1020 WP_284592698.1 hypothetical protein -
  OI909_RS12325 (OI909_12320) - 2497750..2498025 (-) 276 WP_109555175.1 hypothetical protein -
  OI909_RS12330 (OI909_12325) - 2498022..2498738 (-) 717 WP_284592699.1 hypothetical protein -
  OI909_RS12335 (OI909_12330) - 2498741..2500576 (-) 1836 WP_284592700.1 lytic transglycosylase domain-containing protein -
  OI909_RS12340 (OI909_12335) - 2500700..2501284 (-) 585 WP_094934661.1 hypothetical protein -
  OI909_RS12345 (OI909_12340) - 2501287..2501724 (-) 438 WP_023327272.1 hypothetical protein -
  OI909_RS12350 (OI909_12345) - 2501728..2503122 (-) 1395 WP_284592701.1 hypothetical protein -
  OI909_RS12355 (OI909_12350) - 2503127..2504068 (-) 942 WP_097764733.1 hypothetical protein -
  OI909_RS12360 (OI909_12355) - 2504052..2504486 (-) 435 WP_089541778.1 hypothetical protein -
  OI909_RS12365 (OI909_12360) - 2504483..2504911 (-) 429 WP_097764731.1 hypothetical protein -
  OI909_RS12370 (OI909_12365) - 2504908..2505390 (-) 483 WP_284592702.1 hypothetical protein -
  OI909_RS12375 (OI909_12370) - 2505459..2506490 (-) 1032 WP_045407450.1 hypothetical protein -
  OI909_RS12380 (OI909_12375) - 2506507..2507367 (-) 861 WP_284592703.1 hypothetical protein -
  OI909_RS12385 (OI909_12380) - 2507383..2509002 (-) 1620 WP_284592704.1 NUDIX domain-containing protein -
  OI909_RS12390 (OI909_12385) - 2509015..2509845 (-) 831 WP_248894456.1 hypothetical protein -
  OI909_RS12395 (OI909_12390) - 2509842..2511263 (-) 1422 WP_284592707.1 phage portal protein -
  OI909_RS12400 (OI909_12395) - 2511275..2512606 (-) 1332 WP_284592708.1 terminase family protein -
  OI909_RS12405 (OI909_12400) - 2512608..2513348 (-) 741 WP_048976639.1 hypothetical protein -
  OI909_RS12410 (OI909_12405) - 2513410..2513595 (-) 186 WP_048976640.1 hypothetical protein -
  OI909_RS12415 (OI909_12410) - 2513638..2514111 (-) 474 WP_284592709.1 lysis protein -
  OI909_RS12420 (OI909_12415) - 2514108..2514548 (-) 441 WP_023330224.1 lysozyme -
  OI909_RS12425 (OI909_12420) - 2514535..2514840 (-) 306 WP_122008274.1 phage holin family protein -
  OI909_RS12430 (OI909_12425) - 2515145..2515834 (-) 690 WP_047749402.1 bacteriophage antitermination protein Q -
  OI909_RS12435 (OI909_12430) - 2515831..2515947 (-) 117 WP_284592710.1 hypothetical protein -
  OI909_RS12440 (OI909_12435) - 2515944..2516327 (-) 384 WP_078310011.1 hypothetical protein -
  OI909_RS12445 (OI909_12440) - 2516324..2516965 (-) 642 WP_284592711.1 recombination protein NinG -
  OI909_RS12450 (OI909_12445) - 2516958..2517128 (-) 171 WP_284592712.1 NinE family protein -
  OI909_RS12455 (OI909_12450) - 2517128..2517709 (-) 582 WP_052687539.1 NUMOD4 domain-containing protein -
  OI909_RS12460 (OI909_12455) - 2517702..2518133 (-) 432 WP_025759385.1 recombination protein NinB -
  OI909_RS12465 (OI909_12460) - 2518354..2518995 (-) 642 WP_284592714.1 hypothetical protein -
  OI909_RS12470 (OI909_12465) - 2518992..2519429 (-) 438 WP_023311414.1 ead/Ea22-like family protein -
  OI909_RS12475 (OI909_12470) - 2519426..2519647 (-) 222 WP_047720581.1 hypothetical protein -
  OI909_RS12480 (OI909_12475) - 2519644..2520240 (-) 597 WP_348651660.1 hypothetical protein -
  OI909_RS12485 (OI909_12480) - 2520243..2520542 (-) 300 WP_284592715.1 protein ren -
  OI909_RS12490 (OI909_12485) - 2520544..2521233 (-) 690 WP_284592716.1 replication protein P -
  OI909_RS12495 (OI909_12490) - 2521230..2522093 (-) 864 WP_047064366.1 hypothetical protein -
  OI909_RS12500 (OI909_12495) - 2522094..2522681 (-) 588 WP_220131793.1 GIY-YIG nuclease family protein -
  OI909_RS12505 (OI909_12500) - 2522869..2523090 (-) 222 WP_017383074.1 CII family transcriptional regulator -
  OI909_RS12510 (OI909_12505) - 2523131..2523349 (-) 219 WP_047721617.1 helix-turn-helix domain-containing protein -
  OI909_RS12515 (OI909_12510) - 2523452..2524147 (+) 696 WP_047721615.1 helix-turn-helix transcriptional regulator -
  OI909_RS12520 (OI909_12515) - 2524170..2524604 (+) 435 WP_063448422.1 hypothetical protein -
  OI909_RS12525 (OI909_12520) - 2525335..2525676 (+) 342 WP_284592718.1 hypothetical protein -
  OI909_RS12530 (OI909_12525) - 2525833..2526192 (+) 360 WP_284592719.1 hypothetical protein -
  OI909_RS12535 (OI909_12530) - 2526471..2526668 (+) 198 WP_021571179.1 DUF1482 family protein -
  OI909_RS12540 (OI909_12535) - 2526739..2527707 (+) 969 WP_284592722.1 hypothetical protein -
  OI909_RS12545 (OI909_12540) - 2527716..2527913 (+) 198 WP_001303341.1 hypothetical protein -
  OI909_RS12550 (OI909_12545) - 2527910..2528068 (+) 159 WP_157959561.1 hypothetical protein -
  OI909_RS12555 (OI909_12550) - 2528065..2528790 (+) 726 WP_284592723.1 Rad52/Rad22 family DNA repair protein -
  OI909_RS12560 (OI909_12555) - 2528791..2529258 (+) 468 WP_063923477.1 HNH endonuclease -
  OI909_RS12565 (OI909_12560) ssb 2529255..2529704 (+) 450 WP_284592724.1 single-stranded DNA-binding protein Machinery gene
  OI909_RS12570 (OI909_12565) - 2530220..2530558 (+) 339 WP_284592725.1 hypothetical protein -
  OI909_RS12575 (OI909_12570) - 2530569..2530853 (+) 285 WP_021241235.1 DUF5405 family protein -
  OI909_RS12580 (OI909_12575) - 2530850..2531041 (+) 192 WP_284592726.1 DUF2737 family protein -
  OI909_RS12585 (OI909_12580) - 2531038..2531259 (+) 222 WP_164954845.1 hypothetical protein -
  OI909_RS12590 (OI909_12585) - 2531256..2531678 (+) 423 WP_284592727.1 ead/Ea22-like family protein -
  OI909_RS12595 (OI909_12590) - 2531803..2532510 (+) 708 WP_284592728.1 hypothetical protein -
  OI909_RS12600 (OI909_12595) - 2532507..2532752 (+) 246 WP_284592729.1 hypothetical protein -
  OI909_RS12605 (OI909_12600) - 2532903..2533103 (+) 201 WP_284592730.1 hypothetical protein -
  OI909_RS12610 (OI909_12605) - 2533114..2533305 (+) 192 WP_028018495.1 AlpA family phage regulatory protein -
  OI909_RS12615 (OI909_12610) - 2533286..2534464 (-) 1179 WP_284592731.1 site-specific integrase -
  OI909_RS12620 (OI909_12615) sbcB 2534646..2536070 (+) 1425 WP_284592732.1 exodeoxyribonuclease I -

Sequence

Protein


Download         Length: 149 a.a.        Molecular weight: 16481.44 Da        Isoelectric Point: 5.9566

>NTDB_id=748865 OI909_RS12565 WP_284592724.1 2529255..2529704(+) (ssb) [Enterobacter asburiae strain 2017-45-54-05]
MSSRGVNKVILVGNLGQDPEVRYLPSGGAVCSLTLATSESWRDKATGEQKEQTEWHRVVLSGKLAEIAGEYLRKGSEVYL
EGKLRTRKWTDQSGTEKYTTEVLVGVGGTLQMLGGKREGESQPKQQNSQPQQPRQASEPPMNFDDEIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=748865 OI909_RS12565 WP_284592724.1 2529255..2529704(+) (ssb) [Enterobacter asburiae strain 2017-45-54-05]
ATGAGTTCTCGCGGAGTAAACAAAGTGATCCTCGTCGGTAACCTCGGGCAAGACCCCGAGGTCCGTTATCTTCCGTCCGG
CGGCGCAGTGTGCAGCCTGACGCTGGCGACATCGGAGTCATGGCGAGATAAAGCTACTGGCGAGCAGAAAGAGCAAACGG
AATGGCATCGCGTGGTGCTGAGCGGAAAGCTGGCTGAGATTGCCGGTGAATACCTGCGCAAAGGCTCTGAGGTGTATCTG
GAAGGGAAGCTGCGCACTCGCAAATGGACAGATCAGTCAGGTACTGAAAAGTACACCACGGAGGTTCTGGTTGGCGTTGG
CGGAACGCTGCAAATGCTTGGAGGTAAGCGCGAAGGAGAAAGCCAGCCAAAGCAGCAAAATAGCCAGCCGCAACAGCCTA
GGCAGGCAAGCGAACCTCCAATGAACTTCGATGATGAAATACCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-105)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.147

100

0.738
  ssb Glaesserella parasuis strain SC1401

48.619

100

0.591
  ssb Neisseria meningitidis MC58

42.045

100

0.497
  ssb Neisseria gonorrhoeae MS11

42.045

100

0.497