Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | N3Z32_RS22270 | Genome accession | NZ_CP107244 |
| Coordinates | 4931566..4932066 (+) | Length | 166 a.a. |
| NCBI ID | WP_268079545.1 | Uniprot ID | - |
| Organism | Achromobacter sp. SS2-2022 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4895745..4937873 | 4931566..4932066 | within | 0 |
Gene organization within MGE regions
Location: 4895745..4937873
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N3Z32_RS22025 (N3Z32_22040) | - | 4895745..4896251 (-) | 507 | WP_268079498.1 | lysis system i-spanin subunit Rz | - |
| N3Z32_RS22030 (N3Z32_22045) | - | 4896230..4896724 (-) | 495 | WP_268079499.1 | lysozyme | - |
| N3Z32_RS22035 (N3Z32_22050) | - | 4896721..4897008 (-) | 288 | WP_268079500.1 | hypothetical protein | - |
| N3Z32_RS22040 (N3Z32_22055) | - | 4897119..4899314 (-) | 2196 | WP_268079501.1 | glycosyl hydrolase family 28-related protein | - |
| N3Z32_RS22045 (N3Z32_22060) | - | 4899373..4902174 (-) | 2802 | WP_268079502.1 | host specificity factor TipJ family phage tail protein | - |
| N3Z32_RS22050 (N3Z32_22065) | - | 4902418..4902900 (-) | 483 | WP_268079503.1 | DUF1833 family protein | - |
| N3Z32_RS22055 (N3Z32_22070) | - | 4902897..4903358 (-) | 462 | WP_268079504.1 | hypothetical protein | - |
| N3Z32_RS22060 (N3Z32_22075) | - | 4903361..4906321 (-) | 2961 | WP_268079505.1 | tape measure protein | - |
| N3Z32_RS22065 (N3Z32_22080) | - | 4906333..4906962 (-) | 630 | WP_268079506.1 | DUF6246 family protein | - |
| N3Z32_RS22070 (N3Z32_22085) | - | 4906966..4907964 (-) | 999 | WP_268079507.1 | phage tail tube protein | - |
| N3Z32_RS22075 (N3Z32_22090) | - | 4907978..4908346 (-) | 369 | WP_268079508.1 | hypothetical protein | - |
| N3Z32_RS22080 (N3Z32_22095) | - | 4908339..4908776 (-) | 438 | WP_268079509.1 | hypothetical protein | - |
| N3Z32_RS22085 (N3Z32_22100) | - | 4908778..4909116 (-) | 339 | WP_268079510.1 | hypothetical protein | - |
| N3Z32_RS22090 (N3Z32_22105) | - | 4909113..4909502 (-) | 390 | WP_268079511.1 | hypothetical protein | - |
| N3Z32_RS22095 (N3Z32_22110) | - | 4909570..4909881 (-) | 312 | WP_268079512.1 | hypothetical protein | - |
| N3Z32_RS22100 (N3Z32_22115) | - | 4909891..4910946 (-) | 1056 | WP_268079513.1 | major capsid protein | - |
| N3Z32_RS22105 (N3Z32_22120) | - | 4910958..4911425 (-) | 468 | WP_268079514.1 | hypothetical protein | - |
| N3Z32_RS22110 (N3Z32_22125) | - | 4911438..4912676 (-) | 1239 | WP_268079515.1 | hypothetical protein | - |
| N3Z32_RS22115 (N3Z32_22130) | - | 4912679..4913533 (-) | 855 | WP_268079516.1 | phage minor head protein | - |
| N3Z32_RS22120 (N3Z32_22135) | - | 4913577..4914944 (-) | 1368 | WP_268079517.1 | hypothetical protein | - |
| N3Z32_RS22125 (N3Z32_22140) | - | 4914947..4915144 (-) | 198 | WP_268079518.1 | hypothetical protein | - |
| N3Z32_RS22130 (N3Z32_22145) | - | 4915145..4916392 (-) | 1248 | WP_268082505.1 | PBSX family phage terminase large subunit | - |
| N3Z32_RS22135 (N3Z32_22150) | - | 4916379..4916678 (-) | 300 | WP_268079519.1 | hypothetical protein | - |
| N3Z32_RS22140 (N3Z32_22155) | - | 4916843..4917151 (+) | 309 | WP_268079520.1 | hypothetical protein | - |
| N3Z32_RS22145 (N3Z32_22160) | - | 4917235..4917702 (+) | 468 | WP_268079521.1 | hypothetical protein | - |
| N3Z32_RS22150 (N3Z32_22165) | - | 4917767..4918063 (-) | 297 | WP_268079522.1 | hypothetical protein | - |
| N3Z32_RS22155 (N3Z32_22170) | - | 4918060..4918452 (-) | 393 | WP_268079523.1 | hypothetical protein | - |
| N3Z32_RS22160 (N3Z32_22175) | - | 4918445..4918651 (-) | 207 | WP_268079524.1 | hypothetical protein | - |
| N3Z32_RS22165 (N3Z32_22180) | - | 4918785..4919150 (-) | 366 | WP_268079525.1 | endonuclease | - |
| N3Z32_RS22170 (N3Z32_22185) | - | 4919144..4919311 (-) | 168 | WP_268079526.1 | hypothetical protein | - |
| N3Z32_RS22175 (N3Z32_22190) | - | 4919308..4920105 (-) | 798 | WP_268079527.1 | ATP-binding protein | - |
| N3Z32_RS22180 (N3Z32_22195) | - | 4920047..4920808 (-) | 762 | WP_268079528.1 | YdaU family protein | - |
| N3Z32_RS22185 (N3Z32_22200) | - | 4920795..4921151 (-) | 357 | WP_268079529.1 | GIY-YIG nuclease family protein | - |
| N3Z32_RS22190 (N3Z32_22205) | - | 4921148..4921507 (-) | 360 | WP_268079530.1 | Ref family recombination enhancement nuclease | - |
| N3Z32_RS22195 (N3Z32_22210) | - | 4921504..4922025 (-) | 522 | WP_268079531.1 | DUF1367 family protein | - |
| N3Z32_RS22200 (N3Z32_22215) | - | 4922028..4922546 (-) | 519 | WP_268079532.1 | hypothetical protein | - |
| N3Z32_RS22205 (N3Z32_22220) | - | 4922610..4922768 (+) | 159 | WP_268079533.1 | hypothetical protein | - |
| N3Z32_RS22210 (N3Z32_22225) | - | 4922765..4922929 (+) | 165 | WP_268079534.1 | hypothetical protein | - |
| N3Z32_RS22215 (N3Z32_22230) | - | 4922932..4923147 (-) | 216 | WP_268079535.1 | hypothetical protein | - |
| N3Z32_RS22220 (N3Z32_22235) | - | 4923217..4924323 (+) | 1107 | WP_268079536.1 | S24 family peptidase | - |
| N3Z32_RS22225 (N3Z32_22240) | - | 4924390..4925328 (+) | 939 | WP_268079537.1 | hypothetical protein | - |
| N3Z32_RS22230 (N3Z32_22245) | - | 4925370..4925900 (-) | 531 | WP_268079538.1 | hypothetical protein | - |
| N3Z32_RS22235 (N3Z32_22250) | - | 4927366..4927911 (+) | 546 | WP_268079539.1 | hypothetical protein | - |
| N3Z32_RS22240 (N3Z32_22255) | - | 4928399..4928671 (+) | 273 | WP_268079540.1 | hypothetical protein | - |
| N3Z32_RS22245 (N3Z32_22260) | - | 4928673..4928876 (+) | 204 | WP_268079541.1 | hypothetical protein | - |
| N3Z32_RS22250 (N3Z32_22265) | - | 4928873..4929046 (+) | 174 | WP_268079542.1 | hypothetical protein | - |
| N3Z32_RS22255 (N3Z32_22270) | - | 4929048..4930145 (+) | 1098 | WP_277549611.1 | hypothetical protein | - |
| N3Z32_RS22260 (N3Z32_22275) | - | 4930153..4930902 (+) | 750 | WP_277549612.1 | ERF family protein | - |
| N3Z32_RS22265 (N3Z32_22280) | - | 4930895..4931566 (+) | 672 | WP_268079544.1 | hypothetical protein | - |
| N3Z32_RS22270 (N3Z32_22285) | ssb | 4931566..4932066 (+) | 501 | WP_268079545.1 | single-stranded DNA-binding protein | Machinery gene |
| N3Z32_RS22275 (N3Z32_22290) | - | 4932291..4933019 (+) | 729 | WP_268079546.1 | hypothetical protein | - |
| N3Z32_RS22280 (N3Z32_22295) | - | 4933020..4933799 (+) | 780 | WP_268079547.1 | hypothetical protein | - |
| N3Z32_RS22285 (N3Z32_22300) | - | 4933796..4935088 (+) | 1293 | WP_268079548.1 | hypothetical protein | - |
| N3Z32_RS22290 (N3Z32_22305) | - | 4935169..4935450 (+) | 282 | WP_268079549.1 | hypothetical protein | - |
| N3Z32_RS22295 (N3Z32_22310) | - | 4935748..4936020 (+) | 273 | WP_268079550.1 | hypothetical protein | - |
| N3Z32_RS22300 (N3Z32_22315) | - | 4936017..4936193 (+) | 177 | WP_268079551.1 | hypothetical protein | - |
| N3Z32_RS22305 (N3Z32_22320) | - | 4936190..4936645 (+) | 456 | WP_268079552.1 | HAD domain-containing protein | - |
| N3Z32_RS22310 (N3Z32_22325) | - | 4936887..4937873 (+) | 987 | WP_268079553.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18385.39 Da Isoelectric Point: 5.3681
>NTDB_id=738748 N3Z32_RS22270 WP_268079545.1 4931566..4932066(+) (ssb) [Achromobacter sp. SS2-2022]
MASVNKVILVGNLGRDPEVRYNPEGGAICNMSVATTSSWKDKATGEKREETEWHRVVLYNRLAEIAGEYLKKGRSVYLEG
RLKTRKWQDKDTGADRYSTEVVADQMQMLGGRDEGDSAPPERQPQRAPAQRPTSQSNEYANQRGGPAAQSSPAANLADMD
DDLIPF
MASVNKVILVGNLGRDPEVRYNPEGGAICNMSVATTSSWKDKATGEKREETEWHRVVLYNRLAEIAGEYLKKGRSVYLEG
RLKTRKWQDKDTGADRYSTEVVADQMQMLGGRDEGDSAPPERQPQRAPAQRPTSQSNEYANQRGGPAAQSSPAANLADMD
DDLIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=738748 N3Z32_RS22270 WP_268079545.1 4931566..4932066(+) (ssb) [Achromobacter sp. SS2-2022]
ATGGCCAGCGTTAACAAAGTCATTTTGGTGGGCAATCTCGGGCGAGACCCGGAGGTCCGCTACAACCCCGAAGGCGGGGC
CATCTGCAACATGTCCGTAGCCACAACATCCAGTTGGAAGGATAAGGCCACGGGCGAGAAGCGCGAAGAGACCGAATGGC
ACCGCGTCGTCTTGTACAACCGCTTGGCCGAGATTGCCGGCGAGTACTTGAAAAAAGGCCGCTCCGTCTACCTGGAAGGT
CGCCTCAAGACGCGCAAATGGCAGGACAAGGACACTGGCGCCGATCGCTACAGCACCGAAGTGGTGGCCGACCAGATGCA
GATGCTGGGCGGCCGCGACGAGGGCGACAGTGCGCCGCCTGAGCGCCAGCCGCAGCGCGCGCCGGCACAACGCCCGACGA
GCCAGAGCAACGAGTACGCCAACCAACGCGGCGGCCCCGCTGCTCAATCCTCACCAGCGGCGAATCTCGCCGACATGGAC
GACGACTTGATCCCTTTCTGA
ATGGCCAGCGTTAACAAAGTCATTTTGGTGGGCAATCTCGGGCGAGACCCGGAGGTCCGCTACAACCCCGAAGGCGGGGC
CATCTGCAACATGTCCGTAGCCACAACATCCAGTTGGAAGGATAAGGCCACGGGCGAGAAGCGCGAAGAGACCGAATGGC
ACCGCGTCGTCTTGTACAACCGCTTGGCCGAGATTGCCGGCGAGTACTTGAAAAAAGGCCGCTCCGTCTACCTGGAAGGT
CGCCTCAAGACGCGCAAATGGCAGGACAAGGACACTGGCGCCGATCGCTACAGCACCGAAGTGGTGGCCGACCAGATGCA
GATGCTGGGCGGCCGCGACGAGGGCGACAGTGCGCCGCCTGAGCGCCAGCCGCAGCGCGCGCCGGCACAACGCCCGACGA
GCCAGAGCAACGAGTACGCCAACCAACGCGGCGGCCCCGCTGCTCAATCCTCACCAGCGGCGAATCTCGCCGACATGGAC
GACGACTTGATCCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
53.889 |
100 |
0.584 |
| ssb | Glaesserella parasuis strain SC1401 |
50.276 |
100 |
0.548 |
| ssb | Neisseria meningitidis MC58 |
51.412 |
100 |
0.548 |
| ssb | Neisseria gonorrhoeae MS11 |
51.412 |
100 |
0.548 |