NTDB

Overview

Name	ssb	Type	Machinery gene
Locus tag	OGY63_RS15125	Genome accession	NZ_CP107230
Coordinates	3130230..3130766 (+)	Length	178 a.a.
NCBI ID	WP_000168305.1	Uniprot ID	A0A9P2PPK2
Organism	Escherichia coli strain REF2
Function	ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3123421..3143047	3130230..3130766	within	0

Gene organization within MGE regions

Location: 3123421..3143047

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OGY63_RS15100 (OGY63_15055)	-	3123421..3125241 (-)	1821	WP_000704416.1	ATP-binding protein	-
OGY63_RS15105 (OGY63_15060)	aphA	3125518..3126231 (+)	714	WP_001226933.1	acid phosphatase AphA	-
OGY63_RS15110 (OGY63_15065)	yjbQ	3126342..3126758 (+)	417	WP_000270369.1	secondary thiamine-phosphate synthase enzyme YjbQ	-
OGY63_RS15115 (OGY63_15070)	yjbR	3126762..3127118 (+)	357	WP_000153726.1	MmcQ/YjbR family DNA-binding protein	-
OGY63_RS15120 (OGY63_15075)	uvrA	3127153..3129975 (-)	2823	WP_000357755.1	excinuclease ABC subunit UvrA	-
OGY63_RS15125 (OGY63_15080)	ssb	3130230..3130766 (+)	537	WP_000168305.1	single-stranded DNA-binding protein SSB1	Machinery gene
OGY63_RS15130 (OGY63_15085)	-	3130925..3132172 (+)	1248	WP_000414651.1	site-specific integrase	-
OGY63_RS15135 (OGY63_15090)	-	3132159..3133697 (+)	1539	WP_001333349.1	site-specific integrase	-
OGY63_RS15140 (OGY63_15095)	-	3133714..3135747 (+)	2034	WP_000807722.1	hypothetical protein	-
OGY63_RS15145 (OGY63_15100)	-	3135740..3136159 (+)	420	WP_001062122.1	hypothetical protein	-
OGY63_RS15150 (OGY63_15105)	avs4	3136235..3140998 (+)	4764	WP_000240574.1	AVAST type 4 anti-phage nuclease Avs4	-
OGY63_RS15155 (OGY63_15110)	-	3141537..3142358 (-)	822	WP_001272932.1	abortive infection system antitoxin AbiGi family protein	-
OGY63_RS15160 (OGY63_15115)	yjcB	3142766..3143047 (-)	282	WP_001296643.1	YjcB family protein	-

Sequence

Protein

Download Length: 178 a.a. Molecular weight: 18975.00 Da Isoelectric Point: 5.2358

                                >NTDB_id=738692 OGY63_RS15125 WP_000168305.1 3130230..3130766(+) (ssb) [Escherichia coli strain REF2]

MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI

EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA

PAAPSNEPPMDFDDDIPF

Nucleotide

Download Length: 537 bp

                                >NTDB_id=738692 OGY63_RS15125 WP_000168305.1 3130230..3130766(+) (ssb) [Escherichia coli strain REF2]

ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG

TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCCACCGGCGAGATGAAAGAGCAGACTG

AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTAGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC

GAAGGTCAGCTGCGTACCCGCAAATGGACCGATCAATCCGGTCAGGATCGCTATACCACAGAAGTCGTGGTGAACGTTGG

CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCTGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG

GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT

CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGACGATATTCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssb	Vibrio cholerae strain A1552	74.444	100	0.753
ssb	Glaesserella parasuis strain SC1401	57.923	100	0.596
ssb	Neisseria meningitidis MC58	48.066	100	0.489
ssb	Neisseria gonorrhoeae MS11	48.066	100	0.489

Detailed information NTG0738692