Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   DO80_RS06840 Genome accession   NZ_AP019730
Coordinates   1371906..1372031 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain TN2wt     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1366906..1377031
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DO80_RS06820 (DO80_13230) - 1367588..1369000 (-) 1413 WP_108303702.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  DO80_RS06825 (DO80_13240) comB10 1369069..1370205 (-) 1137 WP_108303701.1 DNA type IV secretion system protein ComB10 Machinery gene
  DO80_RS06830 (DO80_13250) comB9 1370198..1371166 (-) 969 WP_108303700.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  DO80_RS06835 (DO80_13260) comB8 1371166..1371909 (-) 744 WP_000660533.1 type IV secretion system protein Machinery gene
  DO80_RS06840 comB7 1371906..1372031 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  DO80_RS06845 (DO80_13270) comB6 1372047..1373102 (-) 1056 WP_108303699.1 P-type conjugative transfer protein TrbL Machinery gene
  DO80_RS06850 (DO80_13280) - 1373110..1374105 (-) 996 WP_108303698.1 PDZ domain-containing protein -
  DO80_RS06855 (DO80_13290) - 1374105..1374398 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  DO80_RS06860 (DO80_13300) panD 1374409..1374759 (-) 351 WP_000142272.1 aspartate 1-decarboxylase -
  DO80_RS06865 (DO80_13310) - 1374749..1376971 (-) 2223 WP_108303697.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=73638 DO80_RS06840 WP_001217874.1 1371906..1372031(-) (comB7) [Helicobacter pylori strain TN2wt]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=73638 DO80_RS06840 WP_001217874.1 1371906..1372031(-) (comB7) [Helicobacter pylori strain TN2wt]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment