Detailed information NTG0734810

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: LLE28_RS11740
• Genome accession: NZ_CP106771
• Coordinates: 55719..55847 (-)
• Length: 42 a.a.
• NCBI ID: WP_317629674.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae strain 10531
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 50719..60847

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLE28_RS00265	pilC	52720..55719 (-)	3000	WP_317629300.1	PilC family type IV pilus tip adhesin	Machinery gene
LLE28_RS11740	pilC	55719..55847 (-)	129	WP_317629674.1	hypothetical protein	Machinery gene
LLE28_RS00270	apbC	57566..58645 (-)	1080	WP_003699443.1	iron-sulfur cluster carrier protein ApbC	-
LLE28_RS00280	-	59019..59528 (+)	510	WP_003687293.1	protein disulfide oxidoreductase	-
LLE28_RS00285	nadR	59869..60309 (+)	441	WP_003687296.1	MarR family adhesin repressor NadR	-

Sequence

Protein

• Length: 42 a.a.
• Molecular weight: 4911.87 Da
• Isoelectric Point: 13.0490

>NTDB_id=734810 LLE28_RS11740 WP_317629674.1 55719..55847(-) (pilC) [Neisseria gonorrhoeae strain 10531]
MNKTLKRRVFRHTALYAAILMFSHTGGRGGGRRRRKRINTLL

Nucleotide

• Length: 129 bp

>NTDB_id=734810 LLE28_RS11740 WP_317629674.1 55719..55847(-) (pilC) [Neisseria gonorrhoeae strain 10531]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GCGGGGGGGGGGCAGGCGCAGGCGCAAACGTATAAATACGCTATTGTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	85.714	0.667