Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   N7985_RS12290 Genome accession   NZ_CP106673
Coordinates   2405228..2405611 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM116268     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2400228..2410611
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7985_RS12250 (N7985_12250) sinI 2401162..2401335 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N7985_RS12255 (N7985_12255) sinR 2401369..2401704 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N7985_RS12260 (N7985_12260) tasA 2401797..2402582 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  N7985_RS12265 (N7985_12265) sipW 2402646..2403218 (-) 573 WP_003246088.1 signal peptidase I SipW -
  N7985_RS12270 (N7985_12270) tapA 2403202..2403963 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  N7985_RS12275 (N7985_12275) yqzG 2404235..2404561 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N7985_RS12280 (N7985_12280) spoIITA 2404603..2404782 (-) 180 WP_003230176.1 YqzE family protein -
  N7985_RS12285 (N7985_12285) comGG 2404853..2405227 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  N7985_RS12290 (N7985_12290) comGF 2405228..2405611 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  N7985_RS12295 (N7985_12295) comGE 2405637..2405984 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  N7985_RS12300 (N7985_12300) comGD 2405968..2406399 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  N7985_RS12305 (N7985_12305) comGC 2406389..2406685 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  N7985_RS12310 (N7985_12310) comGB 2406699..2407736 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  N7985_RS12315 (N7985_12315) comGA 2407723..2408793 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  N7985_RS12320 (N7985_12320) corA 2409204..2410157 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=733971 N7985_RS12290 WP_041850015.1 2405228..2405611(-) (comGF) [Bacillus subtilis strain SRCM116268]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=733971 N7985_RS12290 WP_041850015.1 2405228..2405611(-) (comGF) [Bacillus subtilis strain SRCM116268]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984