Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   N7985_RS12250 Genome accession   NZ_CP106673
Coordinates   2401162..2401335 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM116268     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2396162..2406335
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7985_RS12235 (N7985_12235) gcvT 2396962..2398050 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  N7985_RS12240 (N7985_12240) hepAA 2398491..2400164 (+) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  N7985_RS12245 (N7985_12245) yqhG 2400185..2400979 (+) 795 WP_003230200.1 YqhG family protein -
  N7985_RS12250 (N7985_12250) sinI 2401162..2401335 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N7985_RS12255 (N7985_12255) sinR 2401369..2401704 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N7985_RS12260 (N7985_12260) tasA 2401797..2402582 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  N7985_RS12265 (N7985_12265) sipW 2402646..2403218 (-) 573 WP_003246088.1 signal peptidase I SipW -
  N7985_RS12270 (N7985_12270) tapA 2403202..2403963 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  N7985_RS12275 (N7985_12275) yqzG 2404235..2404561 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N7985_RS12280 (N7985_12280) spoIITA 2404603..2404782 (-) 180 WP_003230176.1 YqzE family protein -
  N7985_RS12285 (N7985_12285) comGG 2404853..2405227 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  N7985_RS12290 (N7985_12290) comGF 2405228..2405611 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  N7985_RS12295 (N7985_12295) comGE 2405637..2405984 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=733968 N7985_RS12250 WP_003230187.1 2401162..2401335(+) (sinI) [Bacillus subtilis strain SRCM116268]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=733968 N7985_RS12250 WP_003230187.1 2401162..2401335(+) (sinI) [Bacillus subtilis strain SRCM116268]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1