Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   N2O69_RS07170 Genome accession   NZ_CP104274
Coordinates   1500162..1500677 (-) Length   171 a.a.
NCBI ID   WP_000168258.1    Uniprot ID   -
Organism   Escherichia coli strain Ec15103     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1495967..1535435 1500162..1500677 within 0


Gene organization within MGE regions


Location: 1495967..1535435
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N2O69_RS07120 torI 1495967..1496167 (-) 201 WP_001163428.1 response regulator inhibitor TorI -
  N2O69_RS07125 - 1496225..1496392 (-) 168 WP_000545733.1 hypothetical protein -
  N2O69_RS07130 - 1496465..1496749 (-) 285 WP_097478915.1 ASCH domain-containing protein -
  N2O69_RS24410 - 1496742..1497173 (-) 432 WP_306308396.1 DUF551 domain-containing protein -
  N2O69_RS24530 - 1497348..1497608 (-) 261 Protein_1394 hypothetical protein -
  N2O69_RS24535 - 1497816..1497941 (-) 126 Protein_1395 hypothetical protein -
  N2O69_RS07145 - 1497943..1498614 (-) 672 Protein_1396 ead/Ea22-like family protein -
  N2O69_RS07150 - 1498590..1499123 (-) 534 WP_106106735.1 hypothetical protein -
  N2O69_RS07155 - 1499120..1499284 (-) 165 WP_106106734.1 DUF2737 family protein -
  N2O69_RS07160 - 1499295..1499588 (-) 294 WP_034169239.1 phage anti-RecBCD protein -
  N2O69_RS07165 - 1499605..1500153 (-) 549 WP_106106733.1 3'-5' exonuclease -
  N2O69_RS07170 ssb 1500162..1500677 (-) 516 WP_000168258.1 single-stranded DNA-binding protein Machinery gene
  N2O69_RS07175 - 1500678..1501385 (-) 708 WP_000365280.1 Rad52/Rad22 family DNA repair protein -
  N2O69_RS07180 kil 1501640..1501792 (-) 153 WP_001243355.1 host cell division inhibitory peptide Kil -
  N2O69_RS07185 - 1501777..1501911 (-) 135 WP_000972063.1 hypothetical protein -
  N2O69_RS07190 - 1501995..1502411 (-) 417 WP_106106732.1 hypothetical protein -
  N2O69_RS07195 - 1502587..1503210 (-) 624 WP_152071948.1 Nmad5 family putative nucleotide modification protein -
  N2O69_RS07200 - 1503222..1503521 (-) 300 WP_106106731.1 hypothetical protein -
  N2O69_RS07205 - 1504130..1504780 (-) 651 WP_000856967.1 LexA family protein -
  N2O69_RS07210 - 1504861..1505046 (+) 186 WP_000276886.1 Cro/CI family transcriptional regulator -
  N2O69_RS07215 - 1505155..1505433 (+) 279 WP_044066512.1 lambda phage CII family protein -
  N2O69_RS07220 - 1505468..1505614 (+) 147 WP_000166207.1 DUF2740 family protein -
  N2O69_RS07225 - 1505607..1506467 (+) 861 WP_000067065.1 replication protein -
  N2O69_RS07230 - 1506575..1508455 (+) 1881 WP_094283591.1 toprim domain-containing protein -
  N2O69_RS07235 - 1508532..1508738 (+) 207 WP_095186730.1 hypothetical protein -
  N2O69_RS07240 - 1508756..1509019 (+) 264 WP_106106730.1 hypothetical protein -
  N2O69_RS07245 - 1509219..1509629 (+) 411 WP_000814617.1 recombination protein NinB -
  N2O69_RS07250 - 1509626..1509802 (+) 177 WP_001254220.1 NinE family protein -
  N2O69_RS07255 - 1509805..1510206 (+) 402 WP_106106729.1 hypothetical protein -
  N2O69_RS07260 - 1510166..1510375 (+) 210 WP_106106728.1 protein NinF -
  N2O69_RS07265 - 1510368..1510637 (+) 270 WP_001279421.1 hypothetical protein -
  N2O69_RS07270 - 1510637..1510927 (+) 291 WP_000002243.1 DUF1364 domain-containing protein -
  N2O69_RS07275 - 1510924..1511286 (+) 363 WP_004031420.1 RusA family crossover junction endodeoxyribonuclease -
  N2O69_RS07280 - 1511283..1511471 (+) 189 WP_000994516.1 protein ninH -
  N2O69_RS07285 - 1511468..1512091 (+) 624 WP_106106727.1 antitermination protein -
  N2O69_RS07290 - 1513060..1513383 (+) 324 WP_000783734.1 phage holin, lambda family -
  N2O69_RS07295 - 1513367..1513843 (+) 477 WP_106106726.1 glycoside hydrolase family protein -
  N2O69_RS07300 - 1513840..1514277 (+) 438 WP_106106725.1 lysis protein -
  N2O69_RS07305 - 1514884..1515126 (+) 243 WP_000807780.1 DUF2560 family protein -
  N2O69_RS07310 - 1515162..1515650 (+) 489 WP_000729922.1 DNA-packaging protein -
  N2O69_RS07315 - 1515628..1517124 (+) 1497 WP_001549451.1 terminase large subunit domain-containing protein -
  N2O69_RS07320 - 1517124..1519325 (+) 2202 WP_113441996.1 portal protein -
  N2O69_RS07325 - 1519416..1520312 (+) 897 WP_001554893.1 hypothetical protein -
  N2O69_RS07330 - 1520333..1521592 (+) 1260 WP_001554894.1 P22 phage major capsid protein family protein -
  N2O69_RS07335 - 1521633..1521821 (+) 189 WP_000078363.1 hypothetical protein -
  N2O69_RS07340 - 1521802..1522263 (+) 462 WP_113441995.1 packaged DNA stabilization gp4 family protein -
  N2O69_RS07345 - 1522273..1523691 (+) 1419 WP_001554896.1 packaged DNA stabilization protein gp10 -
  N2O69_RS07350 - 1523691..1524392 (+) 702 WP_001554897.1 hypothetical protein -
  N2O69_RS07355 - 1524392..1524847 (+) 456 WP_021547409.1 DUF2824 family protein -
  N2O69_RS07360 - 1524850..1525542 (+) 693 WP_001554898.1 hypothetical protein -
  N2O69_RS07365 - 1525553..1526896 (+) 1344 WP_113441994.1 phage DNA ejection protein -
  N2O69_RS07370 - 1526881..1529037 (+) 2157 WP_021557679.1 hypothetical protein -
  N2O69_RS07375 - 1529101..1529523 (-) 423 WP_024227359.1 hypothetical protein -
  N2O69_RS07380 - 1529679..1530647 (+) 969 WP_113441993.1 P63C domain-containing protein -
  N2O69_RS07385 - 1530663..1530917 (-) 255 WP_000170104.1 Arc family DNA-binding protein -
  N2O69_RS07390 - 1531027..1531179 (+) 153 WP_000410309.1 Arc family DNA-binding protein -
  N2O69_RS07395 - 1531176..1531397 (+) 222 WP_023150345.1 hypothetical protein -
  N2O69_RS07400 - 1531460..1532389 (+) 930 WP_113441992.1 phage antirepressor N-terminal domain-containing protein -
  N2O69_RS07405 - 1532490..1535435 (+) 2946 WP_260579668.1 phage tailspike protein -

Sequence

Protein


Download         Length: 171 a.a.        Molecular weight: 19154.38 Da        Isoelectric Point: 8.5373

>NTDB_id=728183 N2O69_RS07170 WP_000168258.1 1500162..1500677(-) (ssb) [Escherichia coli strain Ec15103]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKKTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI

Nucleotide


Download         Length: 516 bp        

>NTDB_id=728183 N2O69_RS07170 WP_000168258.1 1500162..1500677(-) (ssb) [Escherichia coli strain Ec15103]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGAAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGCGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATCGGTTCACTACCGAAGTCATCGTGGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAATGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAGGGAAATCACAGCGAACCACCTATGGATTTTGACGACGATATCCCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.712

100

0.649
  ssb Glaesserella parasuis strain SC1401

52.486

100

0.556
  ssb Neisseria gonorrhoeae MS11

42.045

100

0.433
  ssb Neisseria meningitidis MC58

41.477

100

0.427