Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | N1711_RS03955 | Genome accession | NZ_CP104121 |
| Coordinates | 907642..908139 (-) | Length | 165 a.a. |
| NCBI ID | WP_260273943.1 | Uniprot ID | - |
| Organism | Proteus vulgaris strain USDA-ARS-USMARC-49741 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 905491..947030 | 907642..908139 | within | 0 |
Gene organization within MGE regions
Location: 905491..947030
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1711_RS03920 (N1711_03920) | - | 905491..905679 (-) | 189 | WP_099660096.1 | helix-turn-helix transcriptional regulator | - |
| N1711_RS03925 (N1711_03925) | - | 905733..906188 (-) | 456 | WP_394350849.1 | SAM-dependent methyltransferase | - |
| N1711_RS03930 (N1711_03930) | - | 906190..906411 (-) | 222 | WP_159242314.1 | hypothetical protein | - |
| N1711_RS03935 (N1711_03935) | - | 906422..906595 (-) | 174 | WP_260273942.1 | DUF7167 family protein | - |
| N1711_RS03940 (N1711_03940) | - | 906598..906879 (-) | 282 | WP_218048140.1 | hypothetical protein | - |
| N1711_RS03945 (N1711_03945) | - | 906916..907254 (-) | 339 | WP_224215387.1 | hypothetical protein | - |
| N1711_RS03950 (N1711_03950) | - | 907288..907626 (-) | 339 | WP_224215386.1 | hypothetical protein | - |
| N1711_RS03955 (N1711_03955) | ssb | 907642..908139 (-) | 498 | WP_260273943.1 | single-stranded DNA-binding protein | Machinery gene |
| N1711_RS03960 (N1711_03960) | - | 908132..908665 (-) | 534 | Protein_770 | HD family hydrolase | - |
| N1711_RS03965 (N1711_03965) | rdgC | 908747..909643 (-) | 897 | WP_260273944.1 | recombination-associated protein RdgC | - |
| N1711_RS03970 (N1711_03970) | - | 909943..910437 (+) | 495 | WP_099660100.1 | hypothetical protein | - |
| N1711_RS03975 (N1711_03975) | - | 910649..910852 (-) | 204 | WP_159242319.1 | hypothetical protein | - |
| N1711_RS03980 (N1711_03980) | - | 911205..911867 (-) | 663 | WP_159242320.1 | helix-turn-helix domain-containing protein | - |
| N1711_RS03985 (N1711_03985) | - | 911908..912120 (+) | 213 | WP_109395844.1 | YdaS family helix-turn-helix protein | - |
| N1711_RS03990 (N1711_03990) | - | 912190..912648 (+) | 459 | WP_260273945.1 | YmfL family putative regulatory protein | - |
| N1711_RS03995 (N1711_03995) | - | 912936..913115 (+) | 180 | WP_099659597.1 | DUF4222 domain-containing protein | - |
| N1711_RS04000 (N1711_04000) | - | 913128..914189 (+) | 1062 | WP_260273946.1 | conserved phage C-terminal domain-containing protein | - |
| N1711_RS04005 (N1711_04005) | - | 914189..914827 (+) | 639 | WP_260273947.1 | phage N-6-adenine-methyltransferase | - |
| N1711_RS04010 (N1711_04010) | - | 914824..915216 (+) | 393 | WP_036904905.1 | hypothetical protein | - |
| N1711_RS18620 | - | 915216..915386 (+) | 171 | WP_023582529.1 | Lar family restriction alleviation protein | - |
| N1711_RS04015 (N1711_04015) | - | 915449..915832 (+) | 384 | WP_260273948.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N1711_RS04020 (N1711_04020) | - | 915851..916654 (+) | 804 | WP_036904909.1 | KilA-N domain-containing protein | - |
| N1711_RS04025 (N1711_04025) | - | 916651..917676 (+) | 1026 | WP_260273949.1 | DUF968 domain-containing protein | - |
| N1711_RS04030 (N1711_04030) | - | 917704..918087 (+) | 384 | WP_260273950.1 | antiterminator Q family protein | - |
| N1711_RS04035 (N1711_04035) | - | 918329..919495 (+) | 1167 | WP_036934641.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| N1711_RS04040 (N1711_04040) | - | 919705..919902 (+) | 198 | WP_064720843.1 | hypothetical protein | - |
| N1711_RS04045 (N1711_04045) | - | 920008..920217 (+) | 210 | WP_115350920.1 | hypothetical protein | - |
| N1711_RS04050 (N1711_04050) | - | 920289..920537 (+) | 249 | WP_115350921.1 | hypothetical protein | - |
| N1711_RS04060 (N1711_04060) | - | 920777..921094 (+) | 318 | WP_211849431.1 | phage holin, lambda family | - |
| N1711_RS04065 (N1711_04065) | - | 921087..921506 (+) | 420 | WP_036934635.1 | structural protein | - |
| N1711_RS04070 (N1711_04070) | - | 921706..922284 (+) | 579 | WP_075673907.1 | phage antirepressor N-terminal domain-containing protein | - |
| N1711_RS04075 (N1711_04075) | - | 922322..922729 (+) | 408 | WP_224215380.1 | lysis protein | - |
| N1711_RS04080 (N1711_04080) | - | 923722..924027 (+) | 306 | WP_166539739.1 | hypothetical protein | - |
| N1711_RS04085 (N1711_04085) | - | 924131..924478 (+) | 348 | WP_161751966.1 | HNH endonuclease | - |
| N1711_RS04090 (N1711_04090) | - | 924712..925206 (+) | 495 | WP_260273951.1 | phage terminase small subunit P27 family | - |
| N1711_RS04095 (N1711_04095) | - | 925203..926933 (+) | 1731 | WP_260273952.1 | terminase large subunit | - |
| N1711_RS04100 (N1711_04100) | - | 926930..927091 (+) | 162 | WP_006533924.1 | hypothetical protein | - |
| N1711_RS04105 (N1711_04105) | - | 927081..928310 (+) | 1230 | WP_161770093.1 | phage portal protein | - |
| N1711_RS04110 (N1711_04110) | - | 928300..928905 (+) | 606 | WP_006533922.1 | HK97 family phage prohead protease | - |
| N1711_RS04115 (N1711_04115) | - | 928921..930144 (+) | 1224 | WP_260274134.1 | phage major capsid protein | - |
| N1711_RS04120 (N1711_04120) | - | 930194..930535 (+) | 342 | WP_373370097.1 | head-tail connector protein | - |
| N1711_RS04125 (N1711_04125) | - | 930542..930868 (+) | 327 | WP_260273953.1 | phage head closure protein | - |
| N1711_RS04130 (N1711_04130) | - | 930855..931244 (+) | 390 | WP_260273954.1 | hypothetical protein | - |
| N1711_RS04135 (N1711_04135) | - | 931244..931645 (+) | 402 | WP_190306338.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| N1711_RS04140 (N1711_04140) | - | 931657..932130 (+) | 474 | WP_006533916.1 | hypothetical protein | - |
| N1711_RS04145 (N1711_04145) | - | 932130..932480 (+) | 351 | WP_036904969.1 | phage tail protein | - |
| N1711_RS04150 (N1711_04150) | - | 932525..932734 (+) | 210 | WP_109395812.1 | tail assembly chaperone | - |
| N1711_RS04155 (N1711_04155) | - | 932739..936044 (+) | 3306 | WP_260273955.1 | phage tail tape measure protein | - |
| N1711_RS04160 (N1711_04160) | - | 936045..936644 (+) | 600 | WP_260273956.1 | hypothetical protein | - |
| N1711_RS04165 (N1711_04165) | - | 936641..937222 (+) | 582 | WP_109848301.1 | hypothetical protein | - |
| N1711_RS04170 (N1711_04170) | - | 937246..937854 (+) | 609 | WP_260273957.1 | hypothetical protein | - |
| N1711_RS04175 (N1711_04175) | - | 937911..938309 (+) | 399 | WP_260273958.1 | DUF6950 family protein | - |
| N1711_RS04180 (N1711_04180) | - | 938310..941231 (+) | 2922 | WP_260273959.1 | phage tail tip fiber protein | - |
| N1711_RS04185 (N1711_04185) | - | 941234..942280 (+) | 1047 | WP_260273960.1 | hypothetical protein | - |
| N1711_RS04190 (N1711_04190) | - | 942317..943474 (+) | 1158 | WP_260273961.1 | hypothetical protein | - |
| N1711_RS04195 (N1711_04195) | - | 943624..945456 (+) | 1833 | WP_260273962.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
| N1711_RS04200 (N1711_04200) | - | 945459..945716 (+) | 258 | WP_036969576.1 | bacteriocin immunity protein | - |
| N1711_RS04205 (N1711_04205) | - | 945804..947030 (-) | 1227 | WP_260273963.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 165 a.a. Molecular weight: 18148.60 Da Isoelectric Point: 7.1647
>NTDB_id=727751 N1711_RS03955 WP_260273943.1 907642..908139(-) (ssb) [Proteus vulgaris strain USDA-ARS-USMARC-49741]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYTTEIIVNIGGKMQMLGGASKSAGSQPAQQNQPPAQPQVQSNQPPMDFEDDIPFAPIGLMYPRH
LINVI
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYTTEIIVNIGGKMQMLGGASKSAGSQPAQQNQPPAQPQVQSNQPPMDFEDDIPFAPIGLMYPRH
LINVI
Nucleotide
Download Length: 498 bp
>NTDB_id=727751 N1711_RS03955 WP_260273943.1 907642..908139(-) (ssb) [Proteus vulgaris strain USDA-ARS-USMARC-49741]
ATGGCTAACGGATCAGTGAACAAAGTAATTCTTATCGGCAATTTAGGGCGTGATCCTGAAATTCGTTATCTTCCTTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACATCAGAGAAATGGCGTGACAAACAAACGGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTTGTCTTGTTTGGAAAACTCGCCGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGTGTTAAACGTTATACAACTGAAATAATCGTCAATATTGGTGG
AAAAATGCAAATGCTAGGCGGTGCTAGTAAATCAGCAGGATCACAACCGGCACAGCAAAACCAGCCACCTGCTCAACCTC
AGGTACAAAGCAATCAACCACCAATGGATTTTGAAGATGATATTCCATTCGCTCCGATTGGACTTATGTATCCACGCCAT
TTAATTAATGTGATTTAA
ATGGCTAACGGATCAGTGAACAAAGTAATTCTTATCGGCAATTTAGGGCGTGATCCTGAAATTCGTTATCTTCCTTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACATCAGAGAAATGGCGTGACAAACAAACGGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTTGTCTTGTTTGGAAAACTCGCCGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGTGTTAAACGTTATACAACTGAAATAATCGTCAATATTGGTGG
AAAAATGCAAATGCTAGGCGGTGCTAGTAAATCAGCAGGATCACAACCGGCACAGCAAAACCAGCCACCTGCTCAACCTC
AGGTACAAAGCAATCAACCACCAATGGATTTTGAAGATGATATTCCATTCGCTCCGATTGGACTTATGTATCCACGCCAT
TTAATTAATGTGATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
57.627 |
100 |
0.618 |
| ssb | Glaesserella parasuis strain SC1401 |
47.514 |
100 |
0.521 |
| ssb | Neisseria meningitidis MC58 |
43.103 |
100 |
0.455 |
| ssb | Neisseria gonorrhoeae MS11 |
43.103 |
100 |
0.455 |