Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   NYR48_RS12255 Genome accession   NZ_CP103782
Coordinates   2527404..2527841 (-) Length   145 a.a.
NCBI ID   WP_259424263.1    Uniprot ID   -
Organism   Bacillus velezensis strain DA4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2522404..2532841
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR48_RS12205 sinI 2522788..2522961 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NYR48_RS12210 sinR 2522995..2523330 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NYR48_RS12215 tasA 2523378..2524163 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NYR48_RS12220 sipW 2524228..2524812 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NYR48_RS12225 tapA 2524784..2525455 (-) 672 WP_259424260.1 amyloid fiber anchoring/assembly protein TapA -
  NYR48_RS12230 - 2525714..2526043 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NYR48_RS12235 - 2526083..2526262 (-) 180 WP_003153093.1 YqzE family protein -
  NYR48_RS12240 comGG 2526319..2526696 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  NYR48_RS12245 comGF 2526697..2527197 (-) 501 WP_259424261.1 competence type IV pilus minor pilin ComGF -
  NYR48_RS12250 comGE 2527106..2527420 (-) 315 WP_259424262.1 competence type IV pilus minor pilin ComGE -
  NYR48_RS12255 comGD 2527404..2527841 (-) 438 WP_259424263.1 competence type IV pilus minor pilin ComGD Machinery gene
  NYR48_RS12260 comGC 2527831..2528139 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NYR48_RS12265 comGB 2528144..2529181 (-) 1038 WP_259424264.1 competence type IV pilus assembly protein ComGB Machinery gene
  NYR48_RS12270 comGA 2529168..2530238 (-) 1071 WP_259424265.1 competence type IV pilus ATPase ComGA Machinery gene
  NYR48_RS12275 - 2530432..2531382 (-) 951 WP_259424266.1 magnesium transporter CorA family protein -
  NYR48_RS12280 - 2531528..2532829 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16272.71 Da        Isoelectric Point: 10.2475

>NTDB_id=724858 NYR48_RS12255 WP_259424263.1 2527404..2527841(-) (comGD) [Bacillus velezensis strain DA4]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHISLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=724858 NYR48_RS12255 WP_259424263.1 2527404..2527841(-) (comGD) [Bacillus velezensis strain DA4]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTTCACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572