Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NYR48_RS12205 Genome accession   NZ_CP103782
Coordinates   2522788..2522961 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain DA4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2517788..2527961
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR48_RS12190 gcvT 2518601..2519701 (-) 1101 WP_259424257.1 glycine cleavage system aminomethyltransferase GcvT -
  NYR48_RS12195 - 2520125..2521795 (+) 1671 WP_259424258.1 DEAD/DEAH box helicase -
  NYR48_RS12200 - 2521817..2522611 (+) 795 WP_259424259.1 YqhG family protein -
  NYR48_RS12205 sinI 2522788..2522961 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NYR48_RS12210 sinR 2522995..2523330 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NYR48_RS12215 tasA 2523378..2524163 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NYR48_RS12220 sipW 2524228..2524812 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NYR48_RS12225 tapA 2524784..2525455 (-) 672 WP_259424260.1 amyloid fiber anchoring/assembly protein TapA -
  NYR48_RS12230 - 2525714..2526043 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NYR48_RS12235 - 2526083..2526262 (-) 180 WP_003153093.1 YqzE family protein -
  NYR48_RS12240 comGG 2526319..2526696 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  NYR48_RS12245 comGF 2526697..2527197 (-) 501 WP_259424261.1 competence type IV pilus minor pilin ComGF -
  NYR48_RS12250 comGE 2527106..2527420 (-) 315 WP_259424262.1 competence type IV pilus minor pilin ComGE -
  NYR48_RS12255 comGD 2527404..2527841 (-) 438 WP_259424263.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=724855 NYR48_RS12205 WP_003153105.1 2522788..2522961(+) (sinI) [Bacillus velezensis strain DA4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=724855 NYR48_RS12205 WP_003153105.1 2522788..2522961(+) (sinI) [Bacillus velezensis strain DA4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702