Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   PYW37_RS11965 Genome accession   NZ_CP118969
Coordinates   2339465..2339749 (-) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain DSM 20481     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2334465..2344749
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYW37_RS11935 - 2334897..2335274 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  PYW37_RS11940 - 2335479..2336345 (+) 867 WP_025017140.1 RluA family pseudouridine synthase -
  PYW37_RS11945 - 2336383..2337192 (-) 810 WP_014570791.1 metal ABC transporter permease -
  PYW37_RS11950 - 2337185..2337922 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  PYW37_RS11955 - 2338099..2338941 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  PYW37_RS11960 - 2338938..2339375 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  PYW37_RS11965 comGG 2339465..2339749 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  PYW37_RS11970 comGF 2339788..2340234 (-) 447 WP_032943612.1 competence type IV pilus minor pilin ComGF Machinery gene
  PYW37_RS11975 comGE 2340197..2340493 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  PYW37_RS11980 comGD 2340465..2340881 (-) 417 WP_025017137.1 competence type IV pilus minor pilin ComGD Machinery gene
  PYW37_RS11985 comGC 2340856..2341179 (-) 324 WP_032943614.1 competence type IV pilus major pilin ComGC Machinery gene
  PYW37_RS11990 comGB 2341253..2342272 (-) 1020 WP_044009599.1 competence type IV pilus assembly protein ComGB Machinery gene
  PYW37_RS11995 comGA 2342220..2343158 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=724258 PYW37_RS11965 WP_025017139.1 2339465..2339749(-) (comGG) [Lactococcus lactis strain DSM 20481]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=724258 PYW37_RS11965 WP_025017139.1 2339465..2339749(-) (comGG) [Lactococcus lactis strain DSM 20481]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585