Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   NX856_RS13615 Genome accession   NZ_CP103412
Coordinates   2712045..2712422 (-) Length   125 a.a.
NCBI ID   WP_015240208.1    Uniprot ID   -
Organism   Bacillus velezensis strain HF-14109     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2707045..2717422
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX856_RS13575 (NX856_13575) - 2707543..2708337 (+) 795 WP_208480294.1 YqhG family protein -
  NX856_RS13580 (NX856_13580) sinI 2708514..2708687 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NX856_RS13585 (NX856_13585) sinR 2708721..2709056 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NX856_RS13590 (NX856_13590) tasA 2709104..2709889 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NX856_RS13595 (NX856_13595) sipW 2709954..2710538 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NX856_RS13600 (NX856_13600) tapA 2710510..2711181 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  NX856_RS13605 (NX856_13605) - 2711440..2711769 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NX856_RS13610 (NX856_13610) - 2711809..2711988 (-) 180 WP_003153093.1 YqzE family protein -
  NX856_RS13615 (NX856_13615) comGG 2712045..2712422 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  NX856_RS13620 (NX856_13620) comGF 2712423..2712923 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  NX856_RS13625 (NX856_13625) comGE 2712832..2713146 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  NX856_RS13630 (NX856_13630) comGD 2713130..2713567 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  NX856_RS13635 (NX856_13635) comGC 2713557..2713823 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  NX856_RS13640 (NX856_13640) comGB 2713870..2714907 (-) 1038 WP_218791295.1 competence type IV pilus assembly protein ComGB Machinery gene
  NX856_RS13645 (NX856_13645) comGA 2714894..2715964 (-) 1071 WP_124692840.1 competence type IV pilus ATPase ComGA Machinery gene
  NX856_RS13650 (NX856_13650) - 2716157..2717107 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14123.08 Da        Isoelectric Point: 9.9599

>NTDB_id=722664 NX856_RS13615 WP_015240208.1 2712045..2712422(-) (comGG) [Bacillus velezensis strain HF-14109]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=722664 NX856_RS13615 WP_015240208.1 2712045..2712422(-) (comGG) [Bacillus velezensis strain HF-14109]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512