Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NX856_RS13580 Genome accession   NZ_CP103412
Coordinates   2708514..2708687 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain HF-14109     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2703514..2713687
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX856_RS13565 (NX856_13565) gcvT 2704327..2705427 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  NX856_RS13570 (NX856_13570) - 2705851..2707521 (+) 1671 WP_132105375.1 DEAD/DEAH box helicase -
  NX856_RS13575 (NX856_13575) - 2707543..2708337 (+) 795 WP_208480294.1 YqhG family protein -
  NX856_RS13580 (NX856_13580) sinI 2708514..2708687 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NX856_RS13585 (NX856_13585) sinR 2708721..2709056 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NX856_RS13590 (NX856_13590) tasA 2709104..2709889 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NX856_RS13595 (NX856_13595) sipW 2709954..2710538 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NX856_RS13600 (NX856_13600) tapA 2710510..2711181 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  NX856_RS13605 (NX856_13605) - 2711440..2711769 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NX856_RS13610 (NX856_13610) - 2711809..2711988 (-) 180 WP_003153093.1 YqzE family protein -
  NX856_RS13615 (NX856_13615) comGG 2712045..2712422 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  NX856_RS13620 (NX856_13620) comGF 2712423..2712923 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  NX856_RS13625 (NX856_13625) comGE 2712832..2713146 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  NX856_RS13630 (NX856_13630) comGD 2713130..2713567 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=722662 NX856_RS13580 WP_003153105.1 2708514..2708687(+) (sinI) [Bacillus velezensis strain HF-14109]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=722662 NX856_RS13580 WP_003153105.1 2708514..2708687(+) (sinI) [Bacillus velezensis strain HF-14109]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702