Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NX823_RS21855 Genome accession   NZ_CP103352
Coordinates   4108021..4108539 (-) Length   172 a.a.
NCBI ID   WP_003219228.1    Uniprot ID   A0A063XE16
Organism   Bacillus subtilis strain SRCM117508     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4062567..4108006 4108021..4108539 flank 15


Gene organization within MGE regions


Location: 4062567..4108539
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX823_RS21570 (NX823_21570) yybO 4062983..4064283 (+) 1301 Protein_4193 MFS transporter -
  NX823_RS21575 (NX823_21575) - 4064444..4065180 (+) 737 Protein_4194 MerR family transcriptional regulator -
  NX823_RS21580 (NX823_21580) - 4065218..4066006 (-) 789 WP_129134125.1 hypothetical protein -
  NX823_RS21585 (NX823_21585) yybH 4066074..4066463 (-) 390 WP_014481490.1 nuclear transport factor 2 family protein -
  NX823_RS21590 (NX823_21590) yybG 4066609..4067448 (+) 840 WP_129134126.1 pentapeptide repeat-containing protein -
  NX823_RS21595 (NX823_21595) - 4067484..4068113 (-) 630 Protein_4198 MFS transporter -
  NX823_RS21600 (NX823_21600) - 4068116..4068558 (-) 443 Protein_4199 MBL fold metallo-hydrolase -
  NX823_RS21605 (NX823_21605) yybA 4068688..4069140 (-) 453 WP_003226875.1 MarR family transcriptional regulator -
  NX823_RS21610 (NX823_21610) yyaT 4069260..4069706 (+) 447 WP_258994503.1 GNAT family N-acetyltransferase -
  NX823_RS21615 (NX823_21615) yyaS 4069703..4070305 (+) 603 WP_017695807.1 YitT family protein -
  NX823_RS21620 (NX823_21620) satA 4070373..4070894 (-) 522 WP_258994504.1 streptothricin N-acetyltransferase SatA -
  NX823_RS21625 (NX823_21625) yyaQ 4071303..4071659 (+) 357 WP_258994506.1 MmcQ/YjbR family DNA-binding protein -
  NX823_RS21630 (NX823_21630) yyaP 4071819..4072385 (+) 567 WP_258994507.1 dihydrofolate reductase family protein -
  NX823_RS21635 (NX823_21635) - 4072655..4072814 (+) 160 Protein_4206 DUF255 domain-containing protein -
  NX823_RS21640 (NX823_21640) tet(L) 4072920..4074296 (-) 1377 WP_258994511.1 tetracycline efflux MFS transporter Tet(L) -
  NX823_RS22145 - 4074330..4074512 (-) 183 WP_142387178.1 tetracycline resistance efflux system leader peptide -
  NX823_RS21645 (NX823_21645) - 4074646..4074825 (+) 180 Protein_4209 DUF255 domain-containing protein -
  NX823_RS21650 (NX823_21650) - 4074902..4076413 (+) 1512 WP_160216258.1 recombinase family protein -
  NX823_RS21655 (NX823_21655) - 4076447..4077694 (-) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  NX823_RS21660 (NX823_21660) - 4077823..4078191 (-) 369 WP_144486887.1 hypothetical protein -
  NX823_RS21665 (NX823_21665) - 4078421..4078801 (-) 381 WP_160216296.1 DUF4467 domain-containing protein -
  NX823_RS21670 (NX823_21670) - 4078864..4079370 (-) 507 WP_160216259.1 hypothetical protein -
  NX823_RS21675 (NX823_21675) - 4079385..4080374 (-) 990 WP_160216260.1 bifunctional lytic transglycosylase/C40 family peptidase -
  NX823_RS21680 (NX823_21680) conG 4080371..4082818 (-) 2448 WP_160216261.1 transposon conjugation system subunit ConG -
  NX823_RS21685 (NX823_21685) - 4082822..4083148 (-) 327 WP_031600315.1 YddF family protein -
  NX823_RS21690 (NX823_21690) conE 4083166..4085661 (-) 2496 WP_160216262.1 VirB4-like ATPase ConE -
  NX823_RS21695 (NX823_21695) conD 4085549..4086073 (-) 525 WP_088272256.1 conjugal transfer protein -
  NX823_RS21700 (NX823_21700) conC 4086086..4086334 (-) 249 WP_088272255.1 transposon conjugation system subunit ConC -
  NX823_RS21705 (NX823_21705) conB 4086346..4087410 (-) 1065 WP_088272254.1 conjugal transfer protein -
  NX823_RS21710 (NX823_21710) - 4087438..4087587 (-) 150 WP_003328171.1 hypothetical protein -
  NX823_RS21715 (NX823_21715) - 4087605..4087883 (-) 279 WP_160216263.1 hypothetical protein -
  NX823_RS21720 (NX823_21720) - 4088024..4088260 (+) 237 WP_084992069.1 hypothetical protein -
  NX823_RS21725 (NX823_21725) - 4088364..4088630 (-) 267 WP_160216264.1 hypothetical protein -
  NX823_RS21730 (NX823_21730) - 4088725..4089282 (+) 558 WP_160216265.1 hypothetical protein -
  NX823_RS21735 (NX823_21735) - 4089269..4089541 (-) 273 WP_160216266.1 hypothetical protein -
  NX823_RS21740 (NX823_21740) nikK 4089810..4090868 (-) 1059 WP_160216267.1 replication initiation factor domain-containing protein -
  NX823_RS21745 (NX823_21745) conQ 4090861..4092303 (-) 1443 WP_160216268.1 coupling conjugation protein ConQ -
  NX823_RS21750 (NX823_21750) helP 4092339..4092719 (-) 381 WP_009966619.1 helicase processivity factor HelP -
  NX823_RS21755 (NX823_21755) - 4092755..4092883 (-) 129 WP_119122843.1 hypothetical protein -
  NX823_RS21760 (NX823_21760) - 4093089..4093349 (-) 261 WP_160216269.1 hypothetical protein -
  NX823_RS21765 (NX823_21765) - 4093403..4093627 (-) 225 WP_370957469.1 hypothetical protein -
  NX823_RS21770 (NX823_21770) - 4093660..4093839 (-) 180 WP_019716390.1 hypothetical protein -
  NX823_RS21775 (NX823_21775) - 4094135..4094518 (+) 384 WP_129093547.1 helix-turn-helix domain-containing protein -
  NX823_RS21780 (NX823_21780) - 4094515..4095045 (+) 531 WP_019716392.1 ImmA/IrrE family metallo-endopeptidase -
  NX823_RS21785 (NX823_21785) - 4095158..4096354 (-) 1197 WP_258994544.1 tetratricopeptide repeat protein -
  NX823_RS21790 (NX823_21790) - 4096582..4097301 (-) 720 WP_129093549.1 hypothetical protein -
  NX823_RS21795 (NX823_21795) - 4097577..4097773 (+) 197 Protein_4239 DUF255 domain-containing protein -
  NX823_RS21800 (NX823_21800) - 4097962..4098687 (+) 726 WP_041351256.1 PmeII family type II restriction endonuclease -
  NX823_RS21805 (NX823_21805) dcm 4098751..4100091 (-) 1341 WP_231592845.1 DNA (cytosine-5-)-methyltransferase -
  NX823_RS21810 (NX823_21810) - 4100311..4100472 (+) 162 WP_080316903.1 DUF255 domain-containing protein -
  NX823_RS21815 (NX823_21815) yyaL 4100511..4102400 (+) 1890 WP_258994551.1 thioredoxin domain-containing protein -
  NX823_RS21820 (NX823_21820) yyaK 4102397..4103296 (-) 900 WP_015250787.1 CPBP family intramembrane glutamic endopeptidase -
  NX823_RS21825 (NX823_21825) yyaJ 4103523..4104878 (+) 1356 WP_122895823.1 MFS transporter -
  NX823_RS21830 (NX823_21830) maa 4104912..4105466 (-) 555 WP_033884396.1 sugar O-acetyltransferase -
  NX823_RS21835 (NX823_21835) yyaH 4105484..4105864 (-) 381 WP_003244460.1 VOC family protein -
  NX823_RS21840 (NX823_21840) ccpB 4105920..4106855 (-) 936 WP_258994559.1 transcriptional regulator CcpB -
  NX823_RS21845 (NX823_21845) xth 4106915..4107673 (-) 759 WP_003243194.1 exodeoxyribonuclease III -
  NX823_RS21850 (NX823_21850) rpsR 4107738..4107977 (-) 240 WP_003219224.1 30S ribosomal protein S18 -
  NX823_RS21855 (NX823_21855) ssbA 4108021..4108539 (-) 519 WP_003219228.1 single-stranded DNA-binding protein SsbA Machinery gene

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18742.31 Da        Isoelectric Point: 4.7621

>NTDB_id=722336 NX823_RS21855 WP_003219228.1 4108021..4108539(-) (ssbA) [Bacillus subtilis strain SRCM117508]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=722336 NX823_RS21855 WP_003219228.1 4108021..4108539(-) (ssbA) [Bacillus subtilis strain SRCM117508]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063XE16

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

100

100

1

  ssb Latilactobacillus sakei subsp. sakei 23K

58.192

100

0.599

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

61.628

0.395

  ssb Glaesserella parasuis strain SC1401

35.519

100

0.378