Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NUJ38_RS04755 | Genome accession | NZ_CP102494 |
| Coordinates | 1015281..1015751 (+) | Length | 156 a.a. |
| NCBI ID | WP_301493061.1 | Uniprot ID | - |
| Organism | Gluconobacter oxydans strain ATCC 9937 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1010369..1061575 | 1015281..1015751 | within | 0 |
Gene organization within MGE regions
Location: 1010369..1061575
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ38_RS04730 (NUJ38_04735) | - | 1010626..1011750 (-) | 1125 | WP_301493056.1 | hypothetical protein | - |
| NUJ38_RS04735 (NUJ38_04740) | - | 1011770..1013152 (-) | 1383 | WP_301493057.1 | DEAD/DEAH box helicase | - |
| NUJ38_RS04740 (NUJ38_04745) | - | 1013282..1014109 (+) | 828 | WP_301493058.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| NUJ38_RS04745 (NUJ38_04750) | - | 1014111..1015055 (+) | 945 | WP_301493059.1 | AAA family ATPase | - |
| NUJ38_RS04750 (NUJ38_04755) | - | 1015072..1015281 (+) | 210 | WP_301493060.1 | hypothetical protein | - |
| NUJ38_RS04755 (NUJ38_04760) | ssb | 1015281..1015751 (+) | 471 | WP_301493061.1 | single-stranded DNA-binding protein | Machinery gene |
| NUJ38_RS04760 (NUJ38_04765) | - | 1015804..1015980 (+) | 177 | WP_301493062.1 | hypothetical protein | - |
| NUJ38_RS04765 (NUJ38_04770) | - | 1016036..1017151 (-) | 1116 | WP_301493063.1 | phage late control D family protein | - |
| NUJ38_RS04770 (NUJ38_04775) | - | 1017142..1017357 (-) | 216 | WP_301493064.1 | tail protein X | - |
| NUJ38_RS04775 (NUJ38_04780) | - | 1017344..1017847 (-) | 504 | WP_301493065.1 | phage tail protein | - |
| NUJ38_RS04780 (NUJ38_04785) | - | 1017847..1020444 (-) | 2598 | WP_301493066.1 | hypothetical protein | - |
| NUJ38_RS04785 (NUJ38_04790) | - | 1020575..1020883 (-) | 309 | WP_301493067.1 | phage tail assembly protein | - |
| NUJ38_RS04790 (NUJ38_04795) | - | 1020944..1021453 (-) | 510 | WP_301493068.1 | phage major tail tube protein | - |
| NUJ38_RS04795 (NUJ38_04800) | - | 1021453..1022928 (-) | 1476 | WP_301493069.1 | phage tail sheath C-terminal domain-containing protein | - |
| NUJ38_RS04800 (NUJ38_04805) | - | 1023079..1026165 (-) | 3087 | WP_301493070.1 | phage tail protein | - |
| NUJ38_RS04805 (NUJ38_04810) | - | 1026173..1026700 (-) | 528 | WP_301493071.1 | phage tail protein I | - |
| NUJ38_RS04810 (NUJ38_04815) | - | 1026693..1027598 (-) | 906 | WP_301493072.1 | baseplate J/gp47 family protein | - |
| NUJ38_RS04815 (NUJ38_04820) | - | 1027595..1027933 (-) | 339 | WP_301493073.1 | GPW/gp25 family protein | - |
| NUJ38_RS04820 (NUJ38_04825) | - | 1028010..1028600 (-) | 591 | WP_301493074.1 | phage baseplate assembly protein V | - |
| NUJ38_RS04825 (NUJ38_04830) | - | 1028597..1029154 (-) | 558 | WP_301493075.1 | hypothetical protein | - |
| NUJ38_RS04830 (NUJ38_04835) | - | 1029147..1029581 (-) | 435 | WP_301493076.1 | hypothetical protein | - |
| NUJ38_RS04835 (NUJ38_04840) | - | 1029706..1030044 (-) | 339 | WP_301493077.1 | hypothetical protein | - |
| NUJ38_RS04840 (NUJ38_04845) | - | 1030044..1030205 (-) | 162 | WP_301493078.1 | hypothetical protein | - |
| NUJ38_RS04845 (NUJ38_04850) | - | 1030254..1032188 (-) | 1935 | WP_301493079.1 | phage major capsid protein | - |
| NUJ38_RS04850 (NUJ38_04855) | - | 1032185..1033765 (-) | 1581 | WP_301493080.1 | phage portal protein | - |
| NUJ38_RS04855 (NUJ38_04860) | - | 1033765..1034253 (-) | 489 | WP_301493081.1 | hypothetical protein | - |
| NUJ38_RS04860 (NUJ38_04865) | - | 1034250..1037225 (-) | 2976 | WP_301493082.1 | terminase gpA endonuclease subunit | - |
| NUJ38_RS04865 (NUJ38_04870) | - | 1037266..1037718 (-) | 453 | WP_408874380.1 | terminase small subunit | - |
| NUJ38_RS04870 (NUJ38_04875) | - | 1038155..1038568 (-) | 414 | WP_301493084.1 | hypothetical protein | - |
| NUJ38_RS04875 (NUJ38_04880) | - | 1038561..1038737 (-) | 177 | WP_301493085.1 | hypothetical protein | - |
| NUJ38_RS04880 (NUJ38_04885) | - | 1038734..1038928 (-) | 195 | WP_301493086.1 | hypothetical protein | - |
| NUJ38_RS04885 (NUJ38_04890) | - | 1038931..1039098 (-) | 168 | WP_301493087.1 | hypothetical protein | - |
| NUJ38_RS04890 (NUJ38_04895) | - | 1039098..1039454 (-) | 357 | WP_301493088.1 | hypothetical protein | - |
| NUJ38_RS04895 (NUJ38_04900) | - | 1039451..1039696 (-) | 246 | WP_301493089.1 | hypothetical protein | - |
| NUJ38_RS04900 (NUJ38_04905) | - | 1039714..1040190 (-) | 477 | WP_301493090.1 | glycoside hydrolase family 104 protein | - |
| NUJ38_RS04905 (NUJ38_04910) | - | 1040169..1040438 (-) | 270 | WP_301493091.1 | hypothetical protein | - |
| NUJ38_RS04910 (NUJ38_04915) | - | 1040435..1040740 (-) | 306 | WP_301493092.1 | hypothetical protein | - |
| NUJ38_RS04915 (NUJ38_04920) | - | 1040737..1041144 (-) | 408 | WP_301493093.1 | hypothetical protein | - |
| NUJ38_RS04920 (NUJ38_04925) | - | 1041487..1042395 (+) | 909 | WP_301493094.1 | hypothetical protein | - |
| NUJ38_RS04925 (NUJ38_04930) | - | 1042794..1043672 (+) | 879 | WP_301493095.1 | KilA-N domain-containing protein | - |
| NUJ38_RS04930 (NUJ38_04935) | - | 1043672..1043932 (+) | 261 | WP_301493096.1 | hypothetical protein | - |
| NUJ38_RS04935 (NUJ38_04940) | - | 1043935..1044987 (+) | 1053 | WP_301493097.1 | ParB N-terminal domain-containing protein | - |
| NUJ38_RS04940 (NUJ38_04945) | - | 1044984..1045400 (+) | 417 | WP_301493098.1 | VRR-NUC domain-containing protein | - |
| NUJ38_RS04945 (NUJ38_04950) | - | 1045730..1047946 (+) | 2217 | WP_301493099.1 | topoisomerase | - |
| NUJ38_RS04950 (NUJ38_04955) | - | 1047943..1049343 (+) | 1401 | WP_301493100.1 | DEAD/DEAH box helicase | - |
| NUJ38_RS04955 (NUJ38_04960) | - | 1049345..1049503 (+) | 159 | WP_301493101.1 | hypothetical protein | - |
| NUJ38_RS04960 (NUJ38_04965) | - | 1049500..1049889 (+) | 390 | WP_301493102.1 | hypothetical protein | - |
| NUJ38_RS04965 (NUJ38_04970) | - | 1049886..1050164 (+) | 279 | WP_301493103.1 | hypothetical protein | - |
| NUJ38_RS04970 (NUJ38_04975) | - | 1050331..1050582 (+) | 252 | WP_301493104.1 | AlpA family transcriptional regulator | - |
| NUJ38_RS04975 (NUJ38_04980) | - | 1050579..1051589 (+) | 1011 | WP_301493105.1 | tyrosine-type recombinase/integrase | - |
| NUJ38_RS04985 (NUJ38_04990) | arfB | 1051931..1052353 (+) | 423 | WP_062449265.1 | alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB | - |
| NUJ38_RS04990 (NUJ38_04995) | - | 1052634..1055276 (+) | 2643 | WP_062449263.1 | TonB-dependent siderophore receptor | - |
| NUJ38_RS04995 (NUJ38_05000) | - | 1055430..1058456 (-) | 3027 | WP_301493106.1 | Hint domain-containing protein | - |
| NUJ38_RS05000 (NUJ38_05005) | gyrA | 1058732..1061575 (+) | 2844 | WP_081109680.1 | DNA gyrase subunit A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17491.33 Da Isoelectric Point: 6.4886
>NTDB_id=717320 NUJ38_RS04755 WP_301493061.1 1015281..1015751(+) (ssb) [Gluconobacter oxydans strain ATCC 9937]
MAASLNKVMLIGNLGKDPESRNTQSGSLIVNLTVATSETWKDRQSGEKKEKTEWHRVVIFNEHLGKIAEQYLRKGSKVYL
EGQLQTRKWTDQSGQDKYTTEIVLTAYKGEIVMLSSADRNGEGQSGGQRQNSNSGQRQGGGWDNQKENDLDDEIPF
MAASLNKVMLIGNLGKDPESRNTQSGSLIVNLTVATSETWKDRQSGEKKEKTEWHRVVIFNEHLGKIAEQYLRKGSKVYL
EGQLQTRKWTDQSGQDKYTTEIVLTAYKGEIVMLSSADRNGEGQSGGQRQNSNSGQRQGGGWDNQKENDLDDEIPF
Nucleotide
Download Length: 471 bp
>NTDB_id=717320 NUJ38_RS04755 WP_301493061.1 1015281..1015751(+) (ssb) [Gluconobacter oxydans strain ATCC 9937]
ATGGCCGCATCACTCAATAAGGTCATGCTGATCGGCAATCTGGGCAAAGACCCGGAAAGCCGGAACACGCAGTCGGGAAG
CCTGATCGTCAATCTGACCGTCGCCACGTCCGAGACGTGGAAGGATCGGCAGAGCGGCGAGAAGAAAGAGAAGACCGAAT
GGCACCGGGTCGTCATCTTCAATGAGCACCTGGGCAAGATCGCCGAGCAGTATCTGCGCAAGGGCAGCAAGGTCTATCTT
GAGGGCCAGTTGCAGACACGCAAGTGGACCGACCAGAGCGGACAGGACAAGTACACCACCGAAATCGTCCTGACCGCATA
CAAGGGCGAAATCGTCATGTTGAGTTCTGCGGACCGGAACGGCGAAGGCCAGAGCGGCGGGCAGCGCCAGAACAGTAACA
GCGGCCAGCGTCAGGGCGGCGGATGGGATAACCAGAAGGAGAACGATCTTGACGACGAAATTCCGTTTTAG
ATGGCCGCATCACTCAATAAGGTCATGCTGATCGGCAATCTGGGCAAAGACCCGGAAAGCCGGAACACGCAGTCGGGAAG
CCTGATCGTCAATCTGACCGTCGCCACGTCCGAGACGTGGAAGGATCGGCAGAGCGGCGAGAAGAAAGAGAAGACCGAAT
GGCACCGGGTCGTCATCTTCAATGAGCACCTGGGCAAGATCGCCGAGCAGTATCTGCGCAAGGGCAGCAAGGTCTATCTT
GAGGGCCAGTTGCAGACACGCAAGTGGACCGACCAGAGCGGACAGGACAAGTACACCACCGAAATCGTCCTGACCGCATA
CAAGGGCGAAATCGTCATGTTGAGTTCTGCGGACCGGAACGGCGAAGGCCAGAGCGGCGGGCAGCGCCAGAACAGTAACA
GCGGCCAGCGTCAGGGCGGCGGATGGGATAACCAGAAGGAGAACGATCTTGACGACGAAATTCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
46.821 |
100 |
0.519 |
| ssb | Glaesserella parasuis strain SC1401 |
46.053 |
97.436 |
0.449 |
| ssb | Neisseria meningitidis MC58 |
37.43 |
100 |
0.429 |
| ssb | Neisseria gonorrhoeae MS11 |
37.43 |
100 |
0.429 |