Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NQ486_RS22465 | Genome accession | NZ_CP102257 |
| Coordinates | 5446756..5447220 (-) | Length | 154 a.a. |
| NCBI ID | WP_007832113.1 | Uniprot ID | A0A076ITT6 |
| Organism | Phocaeicola dorei strain DSM 17855 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 5431444..5505616 | 5446756..5447220 | within | 0 |
Gene organization within MGE regions
Location: 5431444..5505616
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ486_RS22390 (NQ486_22390) | - | 5431785..5432351 (-) | 567 | WP_007832154.1 | HdeD family acid-resistance protein | - |
| NQ486_RS22395 (NQ486_22395) | - | 5432599..5432733 (-) | 135 | WP_255323745.1 | hypothetical protein | - |
| NQ486_RS22400 (NQ486_22400) | - | 5432827..5433087 (+) | 261 | WP_007832151.1 | YtxH domain-containing protein | - |
| NQ486_RS22405 (NQ486_22405) | trpB | 5433345..5434544 (+) | 1200 | WP_007832148.1 | tryptophan synthase subunit beta | - |
| NQ486_RS22410 (NQ486_22410) | - | 5434605..5436005 (+) | 1401 | WP_007832146.1 | anthranilate synthase component I family protein | - |
| NQ486_RS22415 (NQ486_22415) | - | 5436018..5436608 (+) | 591 | WP_007832144.1 | anthranilate synthase component II | - |
| NQ486_RS22420 (NQ486_22420) | trpD | 5436630..5437625 (+) | 996 | WP_005839783.1 | anthranilate phosphoribosyltransferase | - |
| NQ486_RS22425 (NQ486_22425) | trpC | 5437664..5438452 (+) | 789 | WP_007832126.1 | indole-3-glycerol phosphate synthase TrpC | - |
| NQ486_RS22430 (NQ486_22430) | - | 5438465..5439082 (+) | 618 | WP_007832125.1 | phosphoribosylanthranilate isomerase | - |
| NQ486_RS22435 (NQ486_22435) | trpA | 5439079..5439855 (+) | 777 | WP_007832122.1 | tryptophan synthase subunit alpha | - |
| NQ486_RS22440 (NQ486_22440) | - | 5440525..5441568 (+) | 1044 | WP_005839772.1 | asparaginase | - |
| NQ486_RS22445 (NQ486_22445) | - | 5441765..5442454 (+) | 690 | WP_007832119.1 | response regulator transcription factor | - |
| NQ486_RS22450 (NQ486_22450) | - | 5442473..5444254 (+) | 1782 | WP_007846292.1 | sensor histidine kinase | - |
| NQ486_RS22455 (NQ486_22455) | - | 5444726..5445352 (-) | 627 | WP_007832116.1 | 4'-phosphopantetheinyl transferase family protein | - |
| NQ486_RS22460 (NQ486_22460) | gldE | 5445361..5446719 (-) | 1359 | WP_007840062.1 | gliding motility-associated protein GldE | - |
| NQ486_RS22465 (NQ486_22465) | ssb | 5446756..5447220 (-) | 465 | WP_007832113.1 | single-stranded DNA-binding protein | Machinery gene |
| NQ486_RS22470 (NQ486_22470) | mutY | 5447235..5448293 (-) | 1059 | WP_007832112.1 | A/G-specific adenine glycosylase | - |
| NQ486_RS22475 (NQ486_22475) | - | 5448473..5448748 (+) | 276 | WP_005839749.1 | HU family DNA-binding protein | - |
| NQ486_RS22480 (NQ486_22480) | - | 5448987..5450561 (+) | 1575 | WP_007840057.1 | ribonuclease E/G | - |
| NQ486_RS22485 (NQ486_22485) | - | 5450733..5451539 (-) | 807 | WP_007832110.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NQ486_RS22490 (NQ486_22490) | - | 5451546..5452088 (-) | 543 | WP_007832102.1 | TlpA family protein disulfide reductase | - |
| NQ486_RS22495 (NQ486_22495) | - | 5452405..5453727 (-) | 1323 | WP_007832101.1 | sigma-54-dependent transcriptional regulator | - |
| NQ486_RS22500 (NQ486_22500) | - | 5453720..5455081 (-) | 1362 | Protein_4408 | hybrid sensor histidine kinase/response regulator | - |
| NQ486_RS22505 (NQ486_22505) | - | 5455082..5455957 (-) | 876 | WP_004329298.1 | radical SAM mobile pair protein B | - |
| NQ486_RS22510 (NQ486_22510) | - | 5455954..5456622 (-) | 669 | WP_032935510.1 | radical SAM mobile pair protein A | - |
| NQ486_RS22515 (NQ486_22515) | - | 5456619..5457395 (-) | 777 | WP_004329300.1 | MBL fold metallo-hydrolase | - |
| NQ486_RS22520 (NQ486_22520) | - | 5457526..5458425 (+) | 900 | WP_004329302.1 | helix-turn-helix domain-containing protein | - |
| NQ486_RS22525 (NQ486_22525) | - | 5458473..5458661 (-) | 189 | WP_005775886.1 | hypothetical protein | - |
| NQ486_RS22530 (NQ486_22530) | - | 5458685..5459344 (+) | 660 | WP_004329304.1 | helix-turn-helix domain-containing protein | - |
| NQ486_RS22535 (NQ486_22535) | - | 5459366..5460313 (-) | 948 | WP_004329305.1 | relaxase/mobilization nuclease domain-containing protein | - |
| NQ486_RS22540 (NQ486_22540) | - | 5460310..5460675 (-) | 366 | WP_004329306.1 | MobC family plasmid mobilization relaxosome protein | - |
| NQ486_RS22545 (NQ486_22545) | - | 5460852..5461745 (-) | 894 | WP_004329307.1 | toprim domain-containing protein | - |
| NQ486_RS22550 (NQ486_22550) | - | 5461735..5463543 (-) | 1809 | WP_004308094.1 | reverse transcriptase/maturase family protein | - |
| NQ486_RS22555 (NQ486_22555) | - | 5464100..5464273 (-) | 174 | Protein_4419 | DNA primase | - |
| NQ486_RS22560 (NQ486_22560) | - | 5464531..5465736 (-) | 1206 | WP_004328112.1 | primase-helicase family protein | - |
| NQ486_RS22565 (NQ486_22565) | - | 5466014..5466403 (-) | 390 | WP_007832095.1 | hypothetical protein | - |
| NQ486_RS22570 (NQ486_22570) | - | 5466400..5467623 (-) | 1224 | WP_005775881.1 | site-specific integrase | - |
| NQ486_RS22575 (NQ486_22575) | - | 5467929..5468669 (+) | 741 | WP_032935620.1 | DUF6064 family protein | - |
| NQ486_RS22580 (NQ486_22580) | lysS | 5468744..5470474 (+) | 1731 | WP_007832091.1 | lysine--tRNA ligase | - |
| NQ486_RS22585 (NQ486_22585) | - | 5470531..5471526 (+) | 996 | WP_007832089.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| NQ486_RS22590 (NQ486_22590) | - | 5471540..5472883 (+) | 1344 | WP_007832087.1 | glucose-6-phosphate isomerase | - |
| NQ486_RS22595 (NQ486_22595) | - | 5473035..5473769 (+) | 735 | WP_007832083.1 | HAD family hydrolase | - |
| NQ486_RS22600 (NQ486_22600) | - | 5473882..5475126 (-) | 1245 | WP_007840049.1 | alpha/beta hydrolase family protein | - |
| NQ486_RS22605 (NQ486_22605) | - | 5475139..5476728 (-) | 1590 | WP_007832079.1 | RagB/SusD family nutrient uptake outer membrane protein | - |
| NQ486_RS22610 (NQ486_22610) | - | 5476744..5480481 (-) | 3738 | WP_007832077.1 | TonB-dependent receptor | - |
| NQ486_RS22615 (NQ486_22615) | - | 5480630..5481712 (-) | 1083 | WP_007832075.1 | FecR family protein | - |
| NQ486_RS22620 (NQ486_22620) | - | 5481920..5482555 (-) | 636 | WP_007832073.1 | RNA polymerase sigma factor | - |
| NQ486_RS22625 (NQ486_22625) | - | 5482670..5483875 (-) | 1206 | WP_005851321.1 | ROK family transcriptional regulator | - |
| NQ486_RS22630 (NQ486_22630) | - | 5484181..5485095 (+) | 915 | WP_007832070.1 | dihydrodipicolinate synthase family protein | - |
| NQ486_RS22635 (NQ486_22635) | - | 5485108..5486304 (+) | 1197 | WP_007832068.1 | AGE family epimerase/isomerase | - |
| NQ486_RS22640 (NQ486_22640) | - | 5486323..5487558 (+) | 1236 | WP_007832066.1 | MFS transporter | - |
| NQ486_RS22645 (NQ486_22645) | nagB | 5487605..5488396 (+) | 792 | WP_007832064.1 | glucosamine-6-phosphate deaminase | - |
| NQ486_RS22650 (NQ486_22650) | - | 5488400..5490388 (+) | 1989 | WP_007832061.1 | glucosamine-6-phosphate deaminase | - |
| NQ486_RS22655 (NQ486_22655) | - | 5490564..5491328 (-) | 765 | WP_007832059.1 | TIGR02757 family protein | - |
| NQ486_RS22660 (NQ486_22660) | - | 5491379..5492257 (-) | 879 | WP_007853779.1 | helix-turn-helix domain-containing protein | - |
| NQ486_RS22665 (NQ486_22665) | - | 5492425..5493492 (+) | 1068 | WP_007832054.1 | efflux RND transporter periplasmic adaptor subunit | - |
| NQ486_RS22670 (NQ486_22670) | - | 5493492..5496617 (+) | 3126 | WP_007832052.1 | efflux RND transporter permease subunit | - |
| NQ486_RS22675 (NQ486_22675) | - | 5496650..5498029 (+) | 1380 | WP_032935617.1 | TolC family protein | - |
| NQ486_RS22680 (NQ486_22680) | - | 5498295..5498921 (-) | 627 | WP_338047449.1 | HU family DNA-binding protein | - |
| NQ486_RS23410 (NQ486_22685) | - | 5498965..5499084 (-) | 120 | WP_007832045.1 | hypothetical protein | - |
| NQ486_RS22690 (NQ486_22690) | - | 5499436..5500110 (+) | 675 | WP_007832037.1 | hypothetical protein | - |
| NQ486_RS22695 (NQ486_22695) | - | 5500412..5500552 (+) | 141 | WP_007832035.1 | hypothetical protein | - |
| NQ486_RS22700 (NQ486_22700) | - | 5500630..5501559 (+) | 930 | WP_007832033.1 | hypothetical protein | - |
| NQ486_RS22705 (NQ486_22705) | - | 5501556..5502233 (+) | 678 | WP_007832030.1 | ATP-binding cassette domain-containing protein | - |
| NQ486_RS22710 (NQ486_22710) | - | 5502292..5504952 (-) | 2661 | WP_007832029.1 | carboxypeptidase-like regulatory domain-containing protein | - |
Sequence
Protein
Download Length: 154 a.a. Molecular weight: 17251.35 Da Isoelectric Point: 7.0120
>NTDB_id=715544 NQ486_RS22465 WP_007832113.1 5446756..5447220(-) (ssb) [Phocaeicola dorei strain DSM 17855]
MSVNKVILIGNVGKDPDVRYLDTGIAVATFSLATTDRAYTLQNGTQVPERTEWHNIVLWRGLAQTAEKYVRKGDKLYIEG
KIRSRSYDDQNGIKRTIVEIFADNMEMLTPRNASQQPGTGYVQAQAVSRQQMSAQVAPQQQQTSDNSLTDDLPF
MSVNKVILIGNVGKDPDVRYLDTGIAVATFSLATTDRAYTLQNGTQVPERTEWHNIVLWRGLAQTAEKYVRKGDKLYIEG
KIRSRSYDDQNGIKRTIVEIFADNMEMLTPRNASQQPGTGYVQAQAVSRQQMSAQVAPQQQQTSDNSLTDDLPF
Nucleotide
Download Length: 465 bp
>NTDB_id=715544 NQ486_RS22465 WP_007832113.1 5446756..5447220(-) (ssb) [Phocaeicola dorei strain DSM 17855]
ATGTCAGTAAATAAAGTCATTTTGATTGGAAATGTAGGAAAGGACCCTGATGTGAGATATTTGGATACCGGCATTGCCGT
TGCCACTTTCTCGTTGGCTACCACCGATCGTGCCTATACGTTGCAGAATGGAACACAGGTTCCCGAACGTACGGAATGGC
ATAATATCGTGTTATGGAGAGGGCTGGCTCAAACTGCGGAAAAATATGTCCGTAAGGGCGACAAACTCTATATAGAAGGA
AAAATCCGTAGCCGTTCATACGATGATCAGAATGGTATAAAACGCACCATTGTCGAGATTTTTGCTGATAATATGGAGAT
GTTGACCCCGCGTAACGCCTCACAGCAACCGGGTACGGGATATGTGCAGGCACAAGCGGTATCCCGGCAGCAGATGTCTG
CACAAGTAGCTCCGCAACAACAGCAAACTTCGGATAATAGCCTGACAGACGATTTACCTTTTTAA
ATGTCAGTAAATAAAGTCATTTTGATTGGAAATGTAGGAAAGGACCCTGATGTGAGATATTTGGATACCGGCATTGCCGT
TGCCACTTTCTCGTTGGCTACCACCGATCGTGCCTATACGTTGCAGAATGGAACACAGGTTCCCGAACGTACGGAATGGC
ATAATATCGTGTTATGGAGAGGGCTGGCTCAAACTGCGGAAAAATATGTCCGTAAGGGCGACAAACTCTATATAGAAGGA
AAAATCCGTAGCCGTTCATACGATGATCAGAATGGTATAAAACGCACCATTGTCGAGATTTTTGCTGATAATATGGAGAT
GTTGACCCCGCGTAACGCCTCACAGCAACCGGGTACGGGATATGTGCAGGCACAAGCGGTATCCCGGCAGCAGATGTCTG
CACAAGTAGCTCCGCAACAACAGCAAACTTCGGATAATAGCCTGACAGACGATTTACCTTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Neisseria meningitidis MC58 |
42.045 |
100 |
0.481 |
| ssb | Neisseria gonorrhoeae MS11 |
46.853 |
92.857 |
0.435 |
| ssb | Glaesserella parasuis strain SC1401 |
37.222 |
100 |
0.435 |
| ssb | Vibrio cholerae strain A1552 |
37.931 |
100 |
0.429 |