Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   NMC97_RS20345 Genome accession   NZ_CP101095
Coordinates   4119950..4120411 (+) Length   153 a.a.
NCBI ID   WP_370612853.1    Uniprot ID   -
Organism   Citrobacter portucalensis strain OT69     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4081088..4124905 4119950..4120411 within 0


Gene organization within MGE regions


Location: 4081088..4124905
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMC97_RS20070 (NMC97_20055) - 4081088..4081495 (-) 408 WP_370612818.1 tail fiber assembly protein -
  NMC97_RS20075 - 4081495..4082562 (-) 1068 WP_370612820.1 hypothetical protein -
  NMC97_RS20080 (NMC97_20065) - 4082648..4083280 (-) 633 WP_370612821.1 hypothetical protein -
  NMC97_RS20085 (NMC97_20070) - 4083325..4084029 (-) 705 WP_370612822.1 hypothetical protein -
  NMC97_RS20090 (NMC97_20075) - 4084031..4085449 (-) 1419 WP_370612823.1 ubiquitin-activating E1 FCCH domain-containing protein -
  NMC97_RS20095 (NMC97_20080) - 4085446..4085778 (-) 333 WP_370612824.1 hypothetical protein -
  NMC97_RS20100 (NMC97_20085) - 4085775..4086491 (-) 717 WP_332247580.1 hypothetical protein -
  NMC97_RS20105 (NMC97_20090) - 4086488..4087528 (-) 1041 WP_370612825.1 hypothetical protein -
  NMC97_RS20110 (NMC97_20095) - 4087528..4087803 (-) 276 WP_332247578.1 hypothetical protein -
  NMC97_RS20115 (NMC97_20100) - 4087800..4088510 (-) 711 WP_268064912.1 hypothetical protein -
  NMC97_RS20120 (NMC97_20105) - 4088510..4090336 (-) 1827 WP_370612826.1 hypothetical protein -
  NMC97_RS20125 (NMC97_20110) - 4090460..4091035 (-) 576 WP_234104999.1 hypothetical protein -
  NMC97_RS20130 (NMC97_20115) - 4091038..4091475 (-) 438 WP_000013027.1 hypothetical protein -
  NMC97_RS20135 (NMC97_20120) - 4091477..4092871 (-) 1395 WP_370612828.1 hypothetical protein -
  NMC97_RS20140 (NMC97_20125) - 4092876..4093817 (-) 942 WP_016152541.1 hypothetical protein -
  NMC97_RS20145 (NMC97_20130) - 4093801..4094235 (-) 435 WP_003833603.1 hypothetical protein -
  NMC97_RS20150 (NMC97_20135) - 4094232..4094660 (-) 429 WP_000213589.1 hypothetical protein -
  NMC97_RS20155 (NMC97_20140) - 4094657..4095139 (-) 483 WP_279653054.1 hypothetical protein -
  NMC97_RS20160 (NMC97_20145) - 4095208..4096239 (-) 1032 WP_370612829.1 DUF2184 domain-containing protein -
  NMC97_RS20165 (NMC97_20150) - 4096256..4097116 (-) 861 WP_370612830.1 hypothetical protein -
  NMC97_RS20170 (NMC97_20155) - 4097132..4098748 (-) 1617 WP_279653053.1 NUDIX domain-containing protein -
  NMC97_RS20175 (NMC97_20160) - 4098761..4099591 (-) 831 WP_000033207.1 hypothetical protein -
  NMC97_RS20180 (NMC97_20165) - 4099588..4101009 (-) 1422 WP_370612832.1 anti-CBASS protein Acb1 family protein -
  NMC97_RS20185 (NMC97_20170) - 4101021..4102352 (-) 1332 WP_108090065.1 terminase large subunit domain-containing protein -
  NMC97_RS20190 (NMC97_20175) - 4102354..4103094 (-) 741 WP_279653051.1 hypothetical protein -
  NMC97_RS20195 (NMC97_20180) - 4103203..4103748 (-) 546 WP_279653050.1 KilA-N domain-containing protein -
  NMC97_RS20200 (NMC97_20185) - 4103925..4104386 (-) 462 WP_279653049.1 lysis protein -
  NMC97_RS20205 (NMC97_20190) - 4104383..4104880 (-) 498 WP_126956159.1 lysozyme -
  NMC97_RS20210 (NMC97_20195) - 4104880..4105095 (-) 216 WP_016160648.1 class II holin family protein -
  NMC97_RS20220 (NMC97_20205) - 4105493..4106176 (-) 684 WP_370612833.1 hypothetical protein -
  NMC97_RS20225 (NMC97_20210) - 4106173..4106634 (-) 462 WP_370612834.1 hypothetical protein -
  NMC97_RS20230 (NMC97_20215) - 4106634..4107296 (-) 663 WP_370612836.1 serine/threonine protein phosphatase -
  NMC97_RS20235 (NMC97_20220) - 4107296..4107751 (-) 456 WP_370612837.1 YbcN family protein -
  NMC97_RS20240 (NMC97_20225) - 4107930..4108214 (-) 285 WP_126956149.1 hypothetical protein -
  NMC97_RS20245 (NMC97_20230) - 4108276..4108956 (-) 681 WP_370612839.1 DUF551 domain-containing protein -
  NMC97_RS20250 (NMC97_20235) - 4108953..4109189 (-) 237 WP_108961747.1 hypothetical protein -
  NMC97_RS20255 (NMC97_20240) - 4109191..4109691 (-) 501 WP_370612840.1 ead/Ea22-like family protein -
  NMC97_RS20260 (NMC97_20245) - 4109688..4110146 (-) 459 WP_370612841.1 hypothetical protein -
  NMC97_RS20265 (NMC97_20250) - 4110436..4110738 (-) 303 WP_208743907.1 hypothetical protein -
  NMC97_RS20270 (NMC97_20255) - 4110738..4112171 (-) 1434 WP_370612842.1 DnaB-like helicase C-terminal domain-containing protein -
  NMC97_RS20275 (NMC97_20260) - 4112161..4113057 (-) 897 WP_370612844.1 DNA replication protein -
  NMC97_RS20280 (NMC97_20265) - 4113044..4113208 (-) 165 WP_370612845.1 hypothetical protein -
  NMC97_RS20285 (NMC97_20270) - 4113201..4113530 (-) 330 WP_370613145.1 CII family transcriptional regulator -
  NMC97_RS20290 (NMC97_20275) - 4113672..4113890 (-) 219 WP_057064744.1 helix-turn-helix domain-containing protein -
  NMC97_RS20295 (NMC97_20280) - 4113957..4114718 (+) 762 WP_226999312.1 S24 family peptidase -
  NMC97_RS20300 (NMC97_20285) - 4114976..4115164 (-) 189 WP_370612847.1 hypothetical protein -
  NMC97_RS20305 (NMC97_20290) - 4115502..4115843 (+) 342 WP_370612848.1 hypothetical protein -
  NMC97_RS20310 (NMC97_20295) - 4116317..4117087 (+) 771 WP_126956129.1 hypothetical protein -
  NMC97_RS20315 (NMC97_20300) - 4117505..4117663 (+) 159 WP_165955302.1 hypothetical protein -
  NMC97_RS20320 (NMC97_20305) - 4117660..4117866 (+) 207 WP_047500189.1 phage encoded cell division inhibitor protein -
  NMC97_RS20325 (NMC97_20310) - 4117876..4118079 (+) 204 WP_370612849.1 hypothetical protein -
  NMC97_RS20330 (NMC97_20315) - 4118165..4119136 (+) 972 WP_370612851.1 hypothetical protein -
  NMC97_RS20335 (NMC97_20320) - 4119145..4119333 (+) 189 WP_117343695.1 hypothetical protein -
  NMC97_RS20340 (NMC97_20325) - 4119341..4119949 (+) 609 WP_370612852.1 ERF family protein -
  NMC97_RS20345 (NMC97_20330) ssb 4119950..4120411 (+) 462 WP_370612853.1 single-stranded DNA-binding protein Machinery gene
  NMC97_RS20350 (NMC97_20335) - 4120466..4120750 (+) 285 WP_370612854.1 hypothetical protein -
  NMC97_RS20355 (NMC97_20340) - 4120743..4121294 (+) 552 WP_370612857.1 phage N-6-adenine-methyltransferase -
  NMC97_RS20360 (NMC97_20345) - 4121291..4121587 (+) 297 WP_370612858.1 DUF4406 domain-containing protein -
  NMC97_RS20365 (NMC97_20350) - 4121685..4121963 (+) 279 WP_370612860.1 hypothetical protein -
  NMC97_RS20370 (NMC97_20355) - 4121960..4122181 (+) 222 WP_370612862.1 TraR/DksA family transcriptional regulator -
  NMC97_RS20375 (NMC97_20360) - 4122181..4122582 (+) 402 WP_370612863.1 phage protein NinX family protein -
  NMC97_RS20380 (NMC97_20365) - 4122572..4122784 (+) 213 WP_370613146.1 DUF4222 domain-containing protein -
  NMC97_RS20385 (NMC97_20370) - 4122794..4123411 (+) 618 WP_370612865.1 Eac protein -
  NMC97_RS20390 (NMC97_20375) - 4123518..4123865 (+) 348 WP_074170635.1 helix-turn-helix domain-containing protein -
  NMC97_RS20395 (NMC97_20380) - 4123748..4124905 (+) 1158 WP_264209222.1 site-specific integrase -

Sequence

Protein


Download         Length: 153 a.a.        Molecular weight: 16929.00 Da        Isoelectric Point: 6.4808

>NTDB_id=708627 NMC97_RS20345 WP_370612853.1 4119950..4120411(+) (ssb) [Citrobacter portucalensis strain OT69]
MASRGVNKVILVGNLGQDPEVRYLPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGVEKYTTEVVVNVGGTMQMLGGKQAEGKSAGNSQQPPRTQQQPVQQHNEPPMDFPDDIPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=708627 NMC97_RS20345 WP_370612853.1 4119950..4120411(+) (ssb) [Citrobacter portucalensis strain OT69]
ATGGCAAGCAGAGGCGTAAATAAAGTGATCCTTGTCGGCAACCTTGGGCAAGACCCTGAAGTTCGCTATCTACCAAATGG
TGGCGCGGTAGCCAATATCACACTGGCAACTTCGGAATCATGGCGGGACAAAGCAACTGGCGAGATGAAAGAGCAGACCG
AATGGCACCGGGTGGTGCTGTTTGGCAAACTGGCGGAAGTCGCCAGCGAATATCTTCGAAAAGGTTCTCAGGTGTATATC
GAAGGCCAGCTCCGCACACGGAAATGGACAGACCAATCTGGTGTCGAGAAGTACACGACTGAAGTTGTTGTGAACGTCGG
CGGCACCATGCAAATGCTTGGCGGGAAGCAAGCAGAAGGTAAATCGGCAGGTAATAGCCAGCAACCACCACGGACGCAGC
AGCAACCGGTACAGCAGCACAACGAGCCGCCTATGGATTTCCCGGATGACATTCCGTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

66.292

100

0.771
  ssb Glaesserella parasuis strain SC1401

48.901

100

0.582
  ssb Neisseria meningitidis MC58

44.966

97.386

0.438
  ssb Neisseria gonorrhoeae MS11

44.966

97.386

0.438