Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LPT18_RS13290 | Genome accession | NZ_CP099508 |
| Coordinates | 2710078..2710548 (+) | Length | 156 a.a. |
| NCBI ID | WP_096002306.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain S82 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2687371..2716271 | 2710078..2710548 | within | 0 |
Gene organization within MGE regions
Location: 2687371..2716271
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT18_RS13130 (LPT18_13130) | groES | 2687371..2687655 (+) | 285 | WP_229355857.1 | co-chaperone GroES | - |
| LPT18_RS13135 (LPT18_13135) | groL | 2687731..2689347 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| LPT18_RS13140 (LPT18_13140) | - | 2689888..2690067 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| LPT18_RS13145 (LPT18_13145) | - | 2690064..2690690 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| LPT18_RS13150 (LPT18_13150) | - | 2691229..2692536 (-) | 1308 | WP_001045074.1 | potassium transporter TrkG | - |
| LPT18_RS13155 (LPT18_13155) | - | 2692919..2694142 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| LPT18_RS13160 (LPT18_13160) | - | 2694574..2695629 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| LPT18_RS13165 (LPT18_13165) | - | 2695651..2696667 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| LPT18_RS13170 (LPT18_13170) | sph | 2696929..2697759 (-) | 831 | Protein_2559 | sphingomyelin phosphodiesterase | - |
| LPT18_RS13175 (LPT18_13175) | - | 2697810..2698847 (-) | 1038 | WP_000857200.1 | site-specific integrase | - |
| LPT18_RS13180 (LPT18_13180) | - | 2699040..2699744 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LPT18_RS13185 (LPT18_13185) | - | 2699884..2700051 (-) | 168 | WP_000694771.1 | hypothetical protein | - |
| LPT18_RS13190 (LPT18_13190) | - | 2700255..2700596 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| LPT18_RS13195 (LPT18_13195) | - | 2700602..2701534 (-) | 933 | WP_096002309.1 | exonuclease domain-containing protein | - |
| LPT18_RS13200 (LPT18_13200) | - | 2701550..2702263 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| LPT18_RS13205 (LPT18_13205) | - | 2702226..2702400 (+) | 175 | Protein_2566 | transcriptional regulator | - |
| LPT18_RS13210 (LPT18_13210) | - | 2702397..2702660 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| LPT18_RS13215 (LPT18_13215) | - | 2702676..2702891 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| LPT18_RS13220 (LPT18_13220) | - | 2702880..2703209 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| LPT18_RS13225 (LPT18_13225) | - | 2703260..2704012 (+) | 753 | WP_096002308.1 | phage antirepressor KilAC domain-containing protein | - |
| LPT18_RS13230 (LPT18_13230) | - | 2704025..2704285 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| LPT18_RS13235 (LPT18_13235) | - | 2704309..2704464 (-) | 156 | Protein_2572 | hypothetical protein | - |
| LPT18_RS13240 (LPT18_13240) | - | 2704519..2704845 (+) | 327 | WP_001025595.1 | hypothetical protein | - |
| LPT18_RS13245 (LPT18_13245) | - | 2704842..2704940 (+) | 99 | Protein_2574 | hypothetical protein | - |
| LPT18_RS13250 (LPT18_13250) | - | 2705090..2705413 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| LPT18_RS13255 (LPT18_13255) | - | 2705410..2705571 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| LPT18_RS13260 (LPT18_13260) | - | 2705666..2705968 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| LPT18_RS13265 (LPT18_13265) | - | 2705973..2706233 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| LPT18_RS13270 (LPT18_13270) | - | 2706242..2706505 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LPT18_RS13275 (LPT18_13275) | - | 2706514..2708457 (+) | 1944 | WP_096002307.1 | AAA family ATPase | - |
| LPT18_RS13280 (LPT18_13280) | - | 2708459..2709379 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| LPT18_RS13285 (LPT18_13285) | - | 2709460..2710077 (+) | 618 | WP_078065545.1 | MBL fold metallo-hydrolase | - |
| LPT18_RS13290 (LPT18_13290) | ssbA | 2710078..2710548 (+) | 471 | WP_096002306.1 | single-stranded DNA-binding protein | Machinery gene |
| LPT18_RS13295 (LPT18_13295) | - | 2710578..2711440 (+) | 863 | Protein_2584 | DnaD domain protein | - |
| LPT18_RS13300 (LPT18_13300) | - | 2711447..2711665 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| LPT18_RS13305 (LPT18_13305) | - | 2711674..2712077 (+) | 404 | Protein_2586 | RusA family crossover junction endodeoxyribonuclease | - |
| LPT18_RS13310 (LPT18_13310) | - | 2712090..2712458 (+) | 369 | WP_096002305.1 | SA1788 family PVL leukocidin-associated protein | - |
| LPT18_RS13315 (LPT18_13315) | - | 2712462..2712704 (+) | 243 | WP_096002304.1 | phi PVL orf 51-like protein | - |
| LPT18_RS13320 (LPT18_13320) | - | 2712719..2712967 (+) | 249 | WP_096002303.1 | DUF1024 family protein | - |
| LPT18_RS13325 (LPT18_13325) | - | 2712960..2713493 (+) | 534 | WP_096002302.1 | dUTP pyrophosphatase | - |
| LPT18_RS13330 (LPT18_13330) | - | 2713530..2713775 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| LPT18_RS13335 (LPT18_13335) | - | 2713772..2713960 (+) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| LPT18_RS13340 (LPT18_13340) | - | 2713935..2714135 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| LPT18_RS13345 (LPT18_13345) | - | 2714138..2714287 (+) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| LPT18_RS13350 (LPT18_13350) | - | 2714446..2715096 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| LPT18_RS13355 (LPT18_13355) | - | 2715096..2715296 (+) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| LPT18_RS13360 (LPT18_13360) | - | 2715324..2715740 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LPT18_RS13365 (LPT18_13365) | - | 2715972..2716271 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=700302 LPT18_RS13290 WP_096002306.1 2710078..2710548(+) (ssbA) [Staphylococcus aureus strain S82]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=700302 LPT18_RS13290 WP_096002306.1 2710078..2710548(+) (ssbA) [Staphylococcus aureus strain S82]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTTACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTTACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |