Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   LPT16_RS13295 Genome accession   NZ_CP099495
Coordinates   2709347..2709817 (+) Length   156 a.a.
NCBI ID   WP_096002306.1    Uniprot ID   -
Organism   Staphylococcus aureus strain JL28     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2686640..2715540 2709347..2709817 within 0


Gene organization within MGE regions


Location: 2686640..2715540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LPT16_RS13135 (LPT16_13135) groES 2686640..2686924 (+) 285 WP_000917289.1 co-chaperone GroES -
  LPT16_RS13140 (LPT16_13140) groL 2687000..2688616 (+) 1617 WP_000240642.1 chaperonin GroEL -
  LPT16_RS13145 (LPT16_13145) - 2689157..2689336 (+) 180 WP_000201398.1 hypothetical protein -
  LPT16_RS13150 (LPT16_13150) - 2689333..2689959 (+) 627 WP_000216896.1 hypothetical protein -
  LPT16_RS13155 (LPT16_13155) - 2690498..2691805 (-) 1308 WP_001045074.1 potassium transporter TrkG -
  LPT16_RS13160 (LPT16_13160) - 2692188..2693411 (-) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  LPT16_RS13165 (LPT16_13165) - 2693843..2694898 (+) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  LPT16_RS13170 (LPT16_13170) - 2694920..2695936 (+) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  LPT16_RS13175 (LPT16_13175) sph 2696198..2697028 (-) 831 Protein_2560 sphingomyelin phosphodiesterase -
  LPT16_RS13180 (LPT16_13180) - 2697079..2698116 (-) 1038 WP_000857200.1 site-specific integrase -
  LPT16_RS13185 (LPT16_13185) - 2698309..2699013 (-) 705 WP_017804779.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LPT16_RS13190 (LPT16_13190) - 2699153..2699320 (-) 168 WP_000694771.1 hypothetical protein -
  LPT16_RS13195 (LPT16_13195) - 2699524..2699865 (-) 342 WP_000591749.1 hypothetical protein -
  LPT16_RS13200 (LPT16_13200) - 2699871..2700803 (-) 933 WP_096002309.1 exonuclease domain-containing protein -
  LPT16_RS13205 (LPT16_13205) - 2700819..2701532 (-) 714 WP_001031454.1 XRE family transcriptional regulator -
  LPT16_RS13210 (LPT16_13210) - 2701495..2701669 (+) 175 Protein_2567 transcriptional regulator -
  LPT16_RS13215 (LPT16_13215) - 2701666..2701929 (+) 264 WP_229360232.1 helix-turn-helix transcriptional regulator -
  LPT16_RS13220 (LPT16_13220) - 2701945..2702160 (+) 216 WP_001025404.1 MW1434 family type I TA system toxin -
  LPT16_RS13225 (LPT16_13225) - 2702149..2702478 (-) 330 WP_000128907.1 hypothetical protein -
  LPT16_RS13230 (LPT16_13230) - 2702529..2703281 (+) 753 WP_096002308.1 phage antirepressor KilAC domain-containing protein -
  LPT16_RS13235 (LPT16_13235) - 2703294..2703554 (+) 261 WP_000435343.1 hypothetical protein -
  LPT16_RS13240 (LPT16_13240) - 2703578..2703733 (-) 156 Protein_2573 hypothetical protein -
  LPT16_RS13245 (LPT16_13245) - 2703788..2704114 (+) 327 WP_001025595.1 hypothetical protein -
  LPT16_RS13250 (LPT16_13250) - 2704111..2704209 (+) 99 Protein_2575 hypothetical protein -
  LPT16_RS13255 (LPT16_13255) - 2704359..2704682 (+) 324 WP_001120201.1 DUF771 domain-containing protein -
  LPT16_RS13260 (LPT16_13260) - 2704679..2704840 (+) 162 WP_000048129.1 DUF1270 family protein -
  LPT16_RS13265 (LPT16_13265) - 2704935..2705237 (+) 303 WP_000165371.1 DUF2482 family protein -
  LPT16_RS13270 (LPT16_13270) - 2705242..2705502 (+) 261 WP_000291510.1 DUF1108 family protein -
  LPT16_RS13275 (LPT16_13275) - 2705511..2705774 (+) 264 WP_001205732.1 hypothetical protein -
  LPT16_RS13280 (LPT16_13280) - 2705783..2707726 (+) 1944 WP_096002307.1 AAA family ATPase -
  LPT16_RS13285 (LPT16_13285) - 2707728..2708648 (+) 921 WP_000138475.1 recombinase RecT -
  LPT16_RS13290 (LPT16_13290) - 2708729..2709346 (+) 618 WP_078065545.1 MBL fold metallo-hydrolase -
  LPT16_RS13295 (LPT16_13295) ssbA 2709347..2709817 (+) 471 WP_096002306.1 single-stranded DNA-binding protein Machinery gene
  LPT16_RS13300 (LPT16_13300) - 2709847..2710709 (+) 863 Protein_2585 DnaD domain protein -
  LPT16_RS13305 (LPT16_13305) - 2710716..2710934 (+) 219 WP_000338530.1 hypothetical protein -
  LPT16_RS13310 (LPT16_13310) - 2710943..2711346 (+) 404 Protein_2587 RusA family crossover junction endodeoxyribonuclease -
  LPT16_RS13315 (LPT16_13315) - 2711359..2711727 (+) 369 WP_096002305.1 SA1788 family PVL leukocidin-associated protein -
  LPT16_RS13320 (LPT16_13320) - 2711731..2711973 (+) 243 WP_096002304.1 phi PVL orf 51-like protein -
  LPT16_RS13325 (LPT16_13325) - 2711988..2712236 (+) 249 WP_096002303.1 DUF1024 family protein -
  LPT16_RS13330 (LPT16_13330) - 2712229..2712762 (+) 534 WP_096002302.1 dUTP pyrophosphatase -
  LPT16_RS13335 (LPT16_13335) - 2712799..2713044 (+) 246 WP_001282074.1 hypothetical protein -
  LPT16_RS13340 (LPT16_13340) - 2713041..2713229 (+) 189 WP_000195782.1 DUF1381 domain-containing protein -
  LPT16_RS13345 (LPT16_13345) - 2713204..2713404 (+) 201 WP_001125015.1 hypothetical protein -
  LPT16_RS13350 (LPT16_13350) - 2713407..2713556 (+) 150 WP_000237868.1 transcriptional activator RinB -
  LPT16_RS13355 (LPT16_13355) - 2713715..2714365 (+) 651 WP_001005262.1 hypothetical protein -
  LPT16_RS13360 (LPT16_13360) - 2714365..2714565 (+) 201 WP_000265042.1 DUF1514 family protein -
  LPT16_RS13365 (LPT16_13365) - 2714593..2715009 (+) 417 WP_000590122.1 hypothetical protein -
  LPT16_RS13370 (LPT16_13370) - 2715241..2715540 (+) 300 WP_000988332.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17657.52 Da        Isoelectric Point: 5.2672

>NTDB_id=700044 LPT16_RS13295 WP_096002306.1 2709347..2709817(+) (ssbA) [Staphylococcus aureus strain JL28]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=700044 LPT16_RS13295 WP_096002306.1 2709347..2709817(+) (ssbA) [Staphylococcus aureus strain JL28]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTTACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.802

100

0.622

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365