Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LPT16_RS13295 | Genome accession | NZ_CP099495 |
| Coordinates | 2709347..2709817 (+) | Length | 156 a.a. |
| NCBI ID | WP_096002306.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain JL28 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2686640..2715540 | 2709347..2709817 | within | 0 |
Gene organization within MGE regions
Location: 2686640..2715540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT16_RS13135 (LPT16_13135) | groES | 2686640..2686924 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| LPT16_RS13140 (LPT16_13140) | groL | 2687000..2688616 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| LPT16_RS13145 (LPT16_13145) | - | 2689157..2689336 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| LPT16_RS13150 (LPT16_13150) | - | 2689333..2689959 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| LPT16_RS13155 (LPT16_13155) | - | 2690498..2691805 (-) | 1308 | WP_001045074.1 | potassium transporter TrkG | - |
| LPT16_RS13160 (LPT16_13160) | - | 2692188..2693411 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| LPT16_RS13165 (LPT16_13165) | - | 2693843..2694898 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| LPT16_RS13170 (LPT16_13170) | - | 2694920..2695936 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| LPT16_RS13175 (LPT16_13175) | sph | 2696198..2697028 (-) | 831 | Protein_2560 | sphingomyelin phosphodiesterase | - |
| LPT16_RS13180 (LPT16_13180) | - | 2697079..2698116 (-) | 1038 | WP_000857200.1 | site-specific integrase | - |
| LPT16_RS13185 (LPT16_13185) | - | 2698309..2699013 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LPT16_RS13190 (LPT16_13190) | - | 2699153..2699320 (-) | 168 | WP_000694771.1 | hypothetical protein | - |
| LPT16_RS13195 (LPT16_13195) | - | 2699524..2699865 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| LPT16_RS13200 (LPT16_13200) | - | 2699871..2700803 (-) | 933 | WP_096002309.1 | exonuclease domain-containing protein | - |
| LPT16_RS13205 (LPT16_13205) | - | 2700819..2701532 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| LPT16_RS13210 (LPT16_13210) | - | 2701495..2701669 (+) | 175 | Protein_2567 | transcriptional regulator | - |
| LPT16_RS13215 (LPT16_13215) | - | 2701666..2701929 (+) | 264 | WP_229360232.1 | helix-turn-helix transcriptional regulator | - |
| LPT16_RS13220 (LPT16_13220) | - | 2701945..2702160 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| LPT16_RS13225 (LPT16_13225) | - | 2702149..2702478 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| LPT16_RS13230 (LPT16_13230) | - | 2702529..2703281 (+) | 753 | WP_096002308.1 | phage antirepressor KilAC domain-containing protein | - |
| LPT16_RS13235 (LPT16_13235) | - | 2703294..2703554 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| LPT16_RS13240 (LPT16_13240) | - | 2703578..2703733 (-) | 156 | Protein_2573 | hypothetical protein | - |
| LPT16_RS13245 (LPT16_13245) | - | 2703788..2704114 (+) | 327 | WP_001025595.1 | hypothetical protein | - |
| LPT16_RS13250 (LPT16_13250) | - | 2704111..2704209 (+) | 99 | Protein_2575 | hypothetical protein | - |
| LPT16_RS13255 (LPT16_13255) | - | 2704359..2704682 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| LPT16_RS13260 (LPT16_13260) | - | 2704679..2704840 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| LPT16_RS13265 (LPT16_13265) | - | 2704935..2705237 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| LPT16_RS13270 (LPT16_13270) | - | 2705242..2705502 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| LPT16_RS13275 (LPT16_13275) | - | 2705511..2705774 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LPT16_RS13280 (LPT16_13280) | - | 2705783..2707726 (+) | 1944 | WP_096002307.1 | AAA family ATPase | - |
| LPT16_RS13285 (LPT16_13285) | - | 2707728..2708648 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| LPT16_RS13290 (LPT16_13290) | - | 2708729..2709346 (+) | 618 | WP_078065545.1 | MBL fold metallo-hydrolase | - |
| LPT16_RS13295 (LPT16_13295) | ssbA | 2709347..2709817 (+) | 471 | WP_096002306.1 | single-stranded DNA-binding protein | Machinery gene |
| LPT16_RS13300 (LPT16_13300) | - | 2709847..2710709 (+) | 863 | Protein_2585 | DnaD domain protein | - |
| LPT16_RS13305 (LPT16_13305) | - | 2710716..2710934 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| LPT16_RS13310 (LPT16_13310) | - | 2710943..2711346 (+) | 404 | Protein_2587 | RusA family crossover junction endodeoxyribonuclease | - |
| LPT16_RS13315 (LPT16_13315) | - | 2711359..2711727 (+) | 369 | WP_096002305.1 | SA1788 family PVL leukocidin-associated protein | - |
| LPT16_RS13320 (LPT16_13320) | - | 2711731..2711973 (+) | 243 | WP_096002304.1 | phi PVL orf 51-like protein | - |
| LPT16_RS13325 (LPT16_13325) | - | 2711988..2712236 (+) | 249 | WP_096002303.1 | DUF1024 family protein | - |
| LPT16_RS13330 (LPT16_13330) | - | 2712229..2712762 (+) | 534 | WP_096002302.1 | dUTP pyrophosphatase | - |
| LPT16_RS13335 (LPT16_13335) | - | 2712799..2713044 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| LPT16_RS13340 (LPT16_13340) | - | 2713041..2713229 (+) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| LPT16_RS13345 (LPT16_13345) | - | 2713204..2713404 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| LPT16_RS13350 (LPT16_13350) | - | 2713407..2713556 (+) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| LPT16_RS13355 (LPT16_13355) | - | 2713715..2714365 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| LPT16_RS13360 (LPT16_13360) | - | 2714365..2714565 (+) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| LPT16_RS13365 (LPT16_13365) | - | 2714593..2715009 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LPT16_RS13370 (LPT16_13370) | - | 2715241..2715540 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=700044 LPT16_RS13295 WP_096002306.1 2709347..2709817(+) (ssbA) [Staphylococcus aureus strain JL28]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=700044 LPT16_RS13295 WP_096002306.1 2709347..2709817(+) (ssbA) [Staphylococcus aureus strain JL28]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTTACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTTACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |