Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NDR85_RS16005 Genome accession   NZ_CP098738
Coordinates   3159877..3160017 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain XE48     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3154877..3165017
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDR85_RS15980 (NDR85_15940) - 3155188..3155568 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  NDR85_RS15985 (NDR85_15945) comA 3155586..3156230 (-) 645 WP_044158945.1 two-component system response regulator ComA Regulator
  NDR85_RS15990 (NDR85_15950) comP 3156311..3158620 (-) 2310 WP_263870718.1 two-component system sensor histidine kinase ComP Regulator
  NDR85_RS15995 (NDR85_15955) comX 3158636..3158803 (-) 168 WP_044158946.1 competence pheromone ComX Regulator
  NDR85_RS16000 (NDR85_15960) comQ 3158787..3159692 (-) 906 WP_044160315.1 polyprenyl synthetase family protein Regulator
  NDR85_RS16005 (NDR85_15965) degQ 3159877..3160017 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  NDR85_RS16010 (NDR85_15970) - 3160478..3160846 (+) 369 WP_044158947.1 hypothetical protein -
  NDR85_RS16015 (NDR85_15975) - 3160822..3162051 (-) 1230 WP_263870719.1 EAL and HDOD domain-containing protein -
  NDR85_RS16020 (NDR85_15980) - 3162187..3163656 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  NDR85_RS16025 (NDR85_15985) - 3163672..3164223 (-) 552 WP_044158950.1 cysteine hydrolase family protein -
  NDR85_RS16030 (NDR85_15990) - 3164320..3164718 (-) 399 WP_263870720.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=697578 NDR85_RS16005 WP_024122683.1 3159877..3160017(-) (degQ) [Bacillus halotolerans strain XE48]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=697578 NDR85_RS16005 WP_024122683.1 3159877..3160017(-) (degQ) [Bacillus halotolerans strain XE48]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978