Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   NDR85_RS15995 Genome accession   NZ_CP098738
Coordinates   3158636..3158803 (-) Length   55 a.a.
NCBI ID   WP_044158946.1    Uniprot ID   -
Organism   Bacillus halotolerans strain XE48     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3153636..3163803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDR85_RS15965 (NDR85_15925) - 3154030..3154506 (+) 477 WP_044158941.1 Na+/H+ antiporter subunit E -
  NDR85_RS15970 (NDR85_15930) - 3154506..3154790 (+) 285 WP_024122677.1 Na(+)/H(+) antiporter subunit F1 -
  NDR85_RS15975 (NDR85_15935) mnhG 3154774..3155148 (+) 375 WP_044158942.1 monovalent cation/H(+) antiporter subunit G -
  NDR85_RS15980 (NDR85_15940) - 3155188..3155568 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  NDR85_RS15985 (NDR85_15945) comA 3155586..3156230 (-) 645 WP_044158945.1 two-component system response regulator ComA Regulator
  NDR85_RS15990 (NDR85_15950) comP 3156311..3158620 (-) 2310 WP_263870718.1 two-component system sensor histidine kinase ComP Regulator
  NDR85_RS15995 (NDR85_15955) comX 3158636..3158803 (-) 168 WP_044158946.1 competence pheromone ComX Regulator
  NDR85_RS16000 (NDR85_15960) comQ 3158787..3159692 (-) 906 WP_044160315.1 polyprenyl synthetase family protein Regulator
  NDR85_RS16005 (NDR85_15965) degQ 3159877..3160017 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  NDR85_RS16010 (NDR85_15970) - 3160478..3160846 (+) 369 WP_044158947.1 hypothetical protein -
  NDR85_RS16015 (NDR85_15975) - 3160822..3162051 (-) 1230 WP_263870719.1 EAL and HDOD domain-containing protein -
  NDR85_RS16020 (NDR85_15980) - 3162187..3163656 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6445.24 Da        Isoelectric Point: 4.5844

>NTDB_id=697576 NDR85_RS15995 WP_044158946.1 3158636..3158803(-) (comX) [Bacillus halotolerans strain XE48]
MQDLINYFLSYPEVLKKLKNREACLIGFSSDETETIIKAYNDYHLSSPTTREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=697576 NDR85_RS15995 WP_044158946.1 3158636..3158803(-) (comX) [Bacillus halotolerans strain XE48]
ATGCAAGACCTAATTAACTACTTTTTAAGTTATCCAGAGGTTTTGAAAAAATTGAAAAATAGAGAAGCTTGCCTTATAGG
TTTTAGTTCAGACGAAACTGAAACAATAATTAAAGCTTATAATGATTATCATCTGTCTAGCCCAACAACCCGTGAATGGG
ATGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

79.245

96.364

0.764