Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NDN18_RS15705 Genome accession   NZ_CP098521
Coordinates   3277349..3277702 (-) Length   117 a.a.
NCBI ID   WP_032058795.1    Uniprot ID   A0A009PIV2
Organism   Acinetobacter baumannii strain Cl107     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3270384..3313273 3277349..3277702 within 0


Gene organization within MGE regions


Location: 3270384..3313273
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDN18_RS15670 (NDN18_15665) - 3270384..3271331 (+) 948 WP_001254615.1 LysR substrate-binding domain-containing protein -
  NDN18_RS15675 (NDN18_15670) - 3271425..3272600 (-) 1176 WP_000843791.1 zinc-binding dehydrogenase -
  NDN18_RS15680 (NDN18_15675) - 3272960..3274050 (+) 1091 WP_085940413.1 IS4-like element ISAba1 family transposase -
  NDN18_RS15685 (NDN18_15680) add 3274192..3275187 (+) 996 WP_000629047.1 adenosine deaminase -
  NDN18_RS15695 (NDN18_15690) - 3275875..3277035 (-) 1161 WP_255878016.1 tyrosine-type recombinase/integrase -
  NDN18_RS15700 (NDN18_15695) - 3277124..3277327 (-) 204 WP_032058794.1 hypothetical protein -
  NDN18_RS15705 (NDN18_15700) ssb 3277349..3277702 (-) 354 WP_032058795.1 single-stranded DNA-binding protein Machinery gene
  NDN18_RS15710 (NDN18_15705) - 3277708..3278049 (-) 342 WP_032058796.1 hypothetical protein -
  NDN18_RS15715 (NDN18_15710) - 3278118..3278708 (-) 591 WP_032058797.1 hypothetical protein -
  NDN18_RS15720 (NDN18_15715) - 3278725..3281451 (-) 2727 WP_211088255.1 toprim domain-containing protein -
  NDN18_RS15725 (NDN18_15720) - 3281461..3281631 (-) 171 WP_004738295.1 hypothetical protein -
  NDN18_RS15730 (NDN18_15725) - 3281646..3281885 (-) 240 WP_114166563.1 hypothetical protein -
  NDN18_RS15735 (NDN18_15730) - 3281888..3282088 (-) 201 WP_114166561.1 hypothetical protein -
  NDN18_RS15740 (NDN18_15735) - 3282172..3282522 (+) 351 WP_004738288.1 hypothetical protein -
  NDN18_RS15745 (NDN18_15740) - 3282519..3283097 (-) 579 WP_114166559.1 hypothetical protein -
  NDN18_RS15750 (NDN18_15745) - 3283094..3283417 (-) 324 WP_004738284.1 hypothetical protein -
  NDN18_RS15755 (NDN18_15750) - 3283833..3284840 (+) 1008 WP_004738282.1 WYL domain-containing protein -
  NDN18_RS15760 (NDN18_15755) - 3284872..3285681 (+) 810 WP_004738281.1 trypsin-like peptidase domain-containing protein -
  NDN18_RS15765 (NDN18_15760) - 3286014..3287285 (-) 1272 WP_255878017.1 acyltransferase -
  NDN18_RS15770 (NDN18_15765) - 3287278..3287631 (-) 354 WP_211088256.1 hypothetical protein -
  NDN18_RS15775 (NDN18_15770) - 3287636..3288031 (-) 396 WP_004738278.1 hypothetical protein -
  NDN18_RS15780 (NDN18_15775) - 3288031..3288318 (-) 288 WP_004738277.1 ogr/Delta-like zinc finger family protein -
  NDN18_RS20480 - 3288437..3288628 (+) 192 WP_079270046.1 Com family DNA-binding transcriptional regulator -
  NDN18_RS15785 (NDN18_15780) - 3288597..3289388 (+) 792 WP_064191562.1 DNA adenine methylase -
  NDN18_RS15790 (NDN18_15785) - 3289385..3290602 (-) 1218 WP_004738275.1 contractile injection system protein, VgrG/Pvc8 family -
  NDN18_RS15795 (NDN18_15790) - 3290606..3291025 (-) 420 WP_064191561.1 phage tail protein -
  NDN18_RS15800 (NDN18_15795) - 3291040..3294669 (-) 3630 WP_255878019.1 phage tail protein -
  NDN18_RS15805 (NDN18_15800) - 3294666..3294734 (-) 69 WP_238826551.1 GpE family phage tail protein -
  NDN18_RS15810 (NDN18_15805) - 3294794..3295174 (-) 381 WP_255878020.1 phage tail assembly protein -
  NDN18_RS15815 (NDN18_15810) - 3295237..3295752 (-) 516 WP_255878021.1 phage major tail tube protein -
  NDN18_RS15820 (NDN18_15815) - 3295764..3296933 (-) 1170 WP_004738266.1 phage tail sheath protein -
  NDN18_RS15825 (NDN18_15820) - 3297042..3297539 (-) 498 WP_005111997.1 hypothetical protein -
  NDN18_RS15830 (NDN18_15825) - 3297541..3300975 (-) 3435 WP_255878022.1 phage tail protein -
  NDN18_RS15835 (NDN18_15830) - 3300976..3301512 (-) 537 WP_005112001.1 phage tail protein I -
  NDN18_RS15840 (NDN18_15835) - 3301512..3302429 (-) 918 WP_005112003.1 baseplate J/gp47 family protein -
  NDN18_RS15845 (NDN18_15840) - 3302426..3302782 (-) 357 WP_196085348.1 GPW/gp25 family protein -
  NDN18_RS15850 (NDN18_15845) - 3302779..3303333 (-) 555 WP_196085347.1 phage baseplate assembly protein V -
  NDN18_RS15855 (NDN18_15850) - 3303394..3303855 (-) 462 WP_032058820.1 phage virion morphogenesis protein -
  NDN18_RS15860 (NDN18_15855) - 3303859..3304389 (-) 531 WP_005112011.1 phage tail protein -
  NDN18_RS15865 (NDN18_15860) - 3304386..3305216 (-) 831 WP_156190991.1 N-acetylmuramidase family protein -
  NDN18_RS15870 (NDN18_15865) - 3305188..3305469 (-) 282 WP_255878023.1 phage holin family protein -
  NDN18_RS15875 (NDN18_15870) - 3305466..3305825 (-) 360 WP_004703727.1 putative holin -
  NDN18_RS15880 (NDN18_15875) - 3305828..3306037 (-) 210 WP_004703729.1 tail protein X -
  NDN18_RS15885 (NDN18_15880) - 3306034..3306483 (-) 450 WP_196085346.1 head completion/stabilization protein -
  NDN18_RS15890 (NDN18_15885) gpM 3306584..3307348 (-) 765 WP_196085345.1 phage terminase small subunit -
  NDN18_RS15895 (NDN18_15890) - 3307355..3308365 (-) 1011 WP_001247975.1 phage major capsid protein, P2 family -
  NDN18_RS15900 (NDN18_15895) - 3308401..3309261 (-) 861 WP_196085344.1 GPO family capsid scaffolding protein -
  NDN18_RS15905 (NDN18_15900) - 3309440..3311218 (+) 1779 WP_196085343.1 terminase family protein -
  NDN18_RS15910 (NDN18_15905) - 3311215..3312261 (+) 1047 WP_254231395.1 phage portal protein -
  NDN18_RS15915 (NDN18_15910) - 3312272..3312487 (+) 216 WP_227552920.1 hypothetical protein -
  NDN18_RS15920 (NDN18_15915) - 3312595..3312774 (+) 180 WP_000009390.1 type II toxin-antitoxin system HicA family toxin -
  NDN18_RS15925 (NDN18_15920) - 3312860..3313273 (+) 414 WP_032058837.1 antitoxin -

Sequence


Protein


Download         Length: 117 a.a.        Molecular weight: 13240.82 Da        Isoelectric Point: 9.8037

>NTDB_id=696577 NDN18_RS15705 WP_032058795.1 3277349..3277702(-) (ssb) [Acinetobacter baumannii strain Cl107]
MRGINKVILVGSLGANPLTKHYPNGNTYVQFSIATSEKYQDKNTGDWIENTEWHRIIAYGRLGETATQLLKKGSKVYVEG
SLRTRQFTDQRGQQGYITEVRANTFQSLDSLPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=696577 NDN18_RS15705 WP_032058795.1 3277349..3277702(-) (ssb) [Acinetobacter baumannii strain Cl107]
ATGCGTGGAATAAATAAGGTGATTTTAGTCGGTTCACTTGGAGCTAATCCATTAACCAAACATTATCCGAATGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACTGGCGATTGGATTGAGAATACAGAATGGC
ATCGCATTATTGCATACGGTCGATTAGGTGAAACGGCCACGCAATTATTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAATTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAATACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A009PIV2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

52.727

94.017

0.496

  ssb Vibrio cholerae strain A1552

52.525

84.615

0.444

  ssb Neisseria meningitidis MC58

42.857

89.744

0.385

  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385