Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   LM6179_RS11390 Genome accession   NZ_CP098509
Coordinates   2219551..2220033 (-) Length   160 a.a.
NCBI ID   WP_038409826.1    Uniprot ID   -
Organism   Listeria monocytogenes 6179     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2194833..2234305 2219551..2220033 within 0


Gene organization within MGE regions


Location: 2194833..2234305
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LM6179_RS11230 (LM6179_01608) - 2194833..2195066 (+) 234 WP_003731277.1 hypothetical protein -
  LM6179_RS11235 (LM6179_01607) - 2195098..2195349 (+) 252 WP_003731276.1 hypothetical protein -
  LM6179_RS11240 (LM6179_01606) acrIIA1 2195350..2195799 (+) 450 WP_038409766.1 anti-CRISPR protein AcrIIA1 -
  LM6179_RS11245 (LM6179_003465) - 2195824..2196321 (+) 498 WP_038409764.1 AP2 domain-containing protein -
  LM6179_RS11250 (LM6179_01970) - 2196580..2197368 (+) 789 WP_223196976.1 DUF3825 domain-containing protein -
  LM6179_RS11255 (LM6179_01969) - 2197409..2198212 (-) 804 WP_038409871.1 N-acetylmuramoyl-L-alanine amidase -
  LM6179_RS11260 (LM6179_01968) - 2198212..2198472 (-) 261 WP_038409869.1 phage holin -
  LM6179_RS11265 (LM6179_01967) - 2198472..2198777 (-) 306 WP_038409867.1 hypothetical protein -
  LM6179_RS11270 (LM6179_01966) - 2198829..2200991 (-) 2163 WP_038409865.1 phage tail spike protein -
  LM6179_RS11275 (LM6179_01965) - 2201004..2202572 (-) 1569 WP_023552439.1 distal tail protein Dit -
  LM6179_RS11280 (LM6179_01964) - 2202569..2207368 (-) 4800 WP_038409862.1 phage tail tape measure protein -
  LM6179_RS11285 (LM6179_01963) - 2207373..2207684 (-) 312 WP_077913501.1 Gp15 family bacteriophage protein -
  LM6179_RS11290 (LM6179_01962) - 2207681..2208112 (-) 432 WP_038409856.1 hypothetical protein -
  LM6179_RS11295 (LM6179_01961) - 2208168..2208857 (-) 690 WP_003733697.1 phage tail tube protein -
  LM6179_RS11300 (LM6179_01960) - 2208862..2209233 (-) 372 WP_003725064.1 hypothetical protein -
  LM6179_RS11305 (LM6179_01959) - 2209230..2209547 (-) 318 WP_003733696.1 HK97 gp10 family phage protein -
  LM6179_RS11310 (LM6179_01958) - 2209537..2209902 (-) 366 WP_003733695.1 hypothetical protein -
  LM6179_RS11315 (LM6179_01957) - 2209902..2210255 (-) 354 WP_003723785.1 hypothetical protein -
  LM6179_RS11320 (LM6179_01956) - 2210256..2210411 (-) 156 WP_003723786.1 hypothetical protein -
  LM6179_RS11325 (LM6179_01955) - 2210425..2211297 (-) 873 WP_003723787.1 hypothetical protein -
  LM6179_RS11330 (LM6179_01954) - 2211320..2211874 (-) 555 WP_003723788.1 hypothetical protein -
  LM6179_RS11335 (LM6179_01953) - 2211970..2213013 (-) 1044 WP_023548506.1 phage minor capsid protein -
  LM6179_RS11340 (LM6179_01952) - 2213018..2214574 (-) 1557 WP_023548504.1 hypothetical protein -
  LM6179_RS11345 (LM6179_01951) - 2214589..2215908 (-) 1320 WP_038409838.1 PBSX family phage terminase large subunit -
  LM6179_RS11350 (LM6179_01950) terS 2215847..2216632 (-) 786 WP_031641733.1 phage terminase small subunit -
  LM6179_RS11355 (LM6179_01949) - 2216672..2216899 (-) 228 WP_012951944.1 hypothetical protein -
  LM6179_RS11360 (LM6179_01948) - 2216981..2217613 (-) 633 WP_031670269.1 hypothetical protein -
  LM6179_RS11365 (LM6179_01947) - 2217771..2218343 (-) 573 WP_038409832.1 sigma-70 family RNA polymerase sigma factor -
  LM6179_RS11370 (LM6179_01946) - 2218431..2218586 (-) 156 WP_003722548.1 hypothetical protein -
  LM6179_RS11375 (LM6179_01945) - 2218605..2218997 (-) 393 WP_031645285.1 DUF2481 family protein -
  LM6179_RS11380 (LM6179_01944) - 2219001..2219405 (-) 405 WP_038409830.1 DUF1064 domain-containing protein -
  LM6179_RS11385 (LM6179_01943) - 2219350..2219532 (-) 183 WP_038409828.1 hypothetical protein -
  LM6179_RS11390 (LM6179_01942) ssbA 2219551..2220033 (-) 483 WP_038409826.1 single-stranded DNA-binding protein Machinery gene
  LM6179_RS11395 (LM6179_01941) - 2220033..2220434 (-) 402 WP_038409823.1 hypothetical protein -
  LM6179_RS11400 (LM6179_01940) - 2220431..2220619 (-) 189 WP_038409820.1 hypothetical protein -
  LM6179_RS11405 (LM6179_01939) - 2220612..2220941 (-) 330 WP_038409818.1 hypothetical protein -
  LM6179_RS11410 (LM6179_003470) - 2220922..2221131 (-) 210 WP_038409816.1 hypothetical protein -
  LM6179_RS11415 (LM6179_01938) - 2221132..2221341 (-) 210 WP_038409814.1 hypothetical protein -
  LM6179_RS11420 (LM6179_01937) - 2221363..2221605 (-) 243 WP_038409811.1 hypothetical protein -
  LM6179_RS11425 (LM6179_01936) - 2221602..2222123 (-) 522 WP_038409808.1 hypothetical protein -
  LM6179_RS11430 (LM6179_01935) - 2222120..2222308 (-) 189 WP_038409807.1 hypothetical protein -
  LM6179_RS11435 (LM6179_01934) - 2222312..2222683 (-) 372 WP_077913500.1 YopX family protein -
  LM6179_RS11440 (LM6179_01933) - 2222680..2223048 (-) 369 WP_038409806.1 hypothetical protein -
  LM6179_RS11445 (LM6179_01932) - 2223045..2223641 (-) 597 WP_038409805.1 DUF1642 domain-containing protein -
  LM6179_RS11450 (LM6179_01931) dcm 2223638..2224918 (-) 1281 WP_038409803.1 DNA (cytosine-5-)-methyltransferase -
  LM6179_RS11455 (LM6179_01930) - 2224915..2225832 (-) 918 WP_038409801.1 DnaD domain-containing protein -
  LM6179_RS11460 (LM6179_01929) - 2225846..2226484 (-) 639 WP_003769987.1 ERF family protein -
  LM6179_RS11465 (LM6179_01928) - 2226489..2226965 (-) 477 WP_003747311.1 siphovirus Gp157 family protein -
  LM6179_RS11470 (LM6179_01927) - 2226962..2227156 (-) 195 WP_009930470.1 hypothetical protein -
  LM6179_RS11475 (LM6179_003475) - 2227251..2227379 (-) 129 WP_256343687.1 hypothetical protein -
  LM6179_RS11480 (LM6179_01926) - 2227458..2227646 (-) 189 WP_003769989.1 gp45 family putative tail fiber system protein -
  LM6179_RS11485 (LM6179_01925) - 2227748..2227954 (-) 207 WP_003733681.1 AlpA family transcriptional regulator -
  LM6179_RS11490 (LM6179_01924) - 2227944..2228474 (-) 531 WP_003733682.1 hypothetical protein -
  LM6179_RS11495 (LM6179_01922) - 2228598..2229374 (-) 777 Protein_2237 phage antirepressor KilAC domain-containing protein -
  LM6179_RS11500 (LM6179_01921) - 2229438..2229635 (+) 198 WP_003733684.1 hypothetical protein -
  LM6179_RS11505 (LM6179_01920) - 2229637..2229918 (-) 282 WP_003722567.1 hypothetical protein -
  LM6179_RS11510 (LM6179_01919) - 2229944..2230228 (-) 285 WP_003733686.1 hypothetical protein -
  LM6179_RS11515 (LM6179_01918) - 2230240..2230434 (-) 195 WP_003733687.1 hypothetical protein -
  LM6179_RS11520 (LM6179_01917) - 2230455..2230664 (-) 210 WP_003733688.1 helix-turn-helix transcriptional regulator -
  LM6179_RS11525 (LM6179_01916) - 2230830..2231252 (+) 423 WP_003724014.1 helix-turn-helix transcriptional regulator -
  LM6179_RS11530 (LM6179_01915) - 2231268..2231693 (+) 426 WP_003724015.1 ImmA/IrrE family metallo-endopeptidase -
  LM6179_RS11535 (LM6179_01914) - 2231708..2232415 (+) 708 WP_003724016.1 hypothetical protein -
  LM6179_RS11540 (LM6179_01913) - 2232474..2233079 (+) 606 WP_003724017.1 hypothetical protein -
  LM6179_RS11545 (LM6179_01912) - 2233142..2234305 (+) 1164 WP_003724018.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17626.38 Da        Isoelectric Point: 4.7915

>NTDB_id=696520 LM6179_RS11390 WP_038409826.1 2219551..2220033(-) (ssbA) [Listeria monocytogenes 6179]
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVYVTEIVAESVQFLEPKQNAVEGSTPNNNQNEASYSNNNKNGSYRASSSQNSDSFANEGKPIDISDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=696520 LM6179_RS11390 WP_038409826.1 2219551..2220033(-) (ssbA) [Listeria monocytogenes 6179]
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACGAAAGATCCTGATTTACGATATACGCCAGCTGGTGCAGCAGTTGC
GACTTTTACATTAGCAGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGTAAACCAGCCGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGACGCGTACAGACTCGT
AATTATGAGGATAACGACGGCAAGCGCGTTTATGTGACGGAAATAGTGGCCGAGAGTGTTCAATTTTTGGAACCTAAGCA
GAACGCTGTAGAAGGCTCTACACCGAATAATAATCAAAACGAAGCTAGTTATTCAAATAACAATAAAAACGGCTCATATC
GAGCTAGTTCGAGCCAGAATAGTGATTCATTTGCAAACGAAGGTAAGCCGATTGATATTTCAGATGACGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

64.535

100

0.694
  ssb Latilactobacillus sakei subsp. sakei 23K

55.882

100

0.594
  ssbB Bacillus subtilis subsp. subtilis str. 168

66.038

66.25

0.438
  ssb Glaesserella parasuis strain SC1401

32.768

100

0.362