Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NCL52_RS12360 Genome accession   NZ_CP098417
Coordinates   2422052..2422426 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain N2-10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2417052..2427426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NCL52_RS12320 (NCL52_12320) yqhG 2417383..2418177 (+) 795 WP_003230200.1 YqhG family protein -
  NCL52_RS12325 (NCL52_12325) sinI 2418360..2418533 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NCL52_RS12330 (NCL52_12330) sinR 2418567..2418902 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NCL52_RS12335 (NCL52_12335) tasA 2418995..2419780 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  NCL52_RS12340 (NCL52_12340) sipW 2419844..2420416 (-) 573 WP_128738626.1 signal peptidase I SipW -
  NCL52_RS12345 (NCL52_12345) tapA 2420400..2421161 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  NCL52_RS12350 (NCL52_12350) yqzG 2421434..2421760 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  NCL52_RS12355 (NCL52_12355) spoIITA 2421802..2421981 (-) 180 WP_014480252.1 YqzE family protein -
  NCL52_RS12360 (NCL52_12360) comGG 2422052..2422426 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NCL52_RS12365 (NCL52_12365) comGF 2422427..2422810 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  NCL52_RS12370 (NCL52_12370) comGE 2422836..2423183 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene
  NCL52_RS12375 (NCL52_12375) comGD 2423167..2423598 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  NCL52_RS12380 (NCL52_12380) comGC 2423588..2423884 (-) 297 WP_024573391.1 comG operon protein ComGC Machinery gene
  NCL52_RS12385 (NCL52_12385) comGB 2423898..2424935 (-) 1038 WP_128738021.1 comG operon protein ComGB Machinery gene
  NCL52_RS12390 (NCL52_12390) comGA 2424922..2425992 (-) 1071 WP_128738022.1 competence protein ComGA Machinery gene
  NCL52_RS20750 - 2426203..2426328 (-) 126 WP_003230155.1 hypothetical protein -
  NCL52_RS12395 (NCL52_12395) corA 2426394..2427347 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=695384 NCL52_RS12360 WP_014480253.1 2422052..2422426(-) (comGG) [Bacillus subtilis strain N2-10]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=695384 NCL52_RS12360 WP_014480253.1 2422052..2422426(-) (comGG) [Bacillus subtilis strain N2-10]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976