Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NCL52_RS12325 Genome accession   NZ_CP098417
Coordinates   2418360..2418533 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N2-10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2413360..2423533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NCL52_RS12310 (NCL52_12310) gcvT 2414159..2415247 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  NCL52_RS12315 (NCL52_12315) hepAA 2415689..2417362 (+) 1674 WP_124058586.1 SNF2-related protein -
  NCL52_RS12320 (NCL52_12320) yqhG 2417383..2418177 (+) 795 WP_003230200.1 YqhG family protein -
  NCL52_RS12325 (NCL52_12325) sinI 2418360..2418533 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NCL52_RS12330 (NCL52_12330) sinR 2418567..2418902 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NCL52_RS12335 (NCL52_12335) tasA 2418995..2419780 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  NCL52_RS12340 (NCL52_12340) sipW 2419844..2420416 (-) 573 WP_128738626.1 signal peptidase I SipW -
  NCL52_RS12345 (NCL52_12345) tapA 2420400..2421161 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  NCL52_RS12350 (NCL52_12350) yqzG 2421434..2421760 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  NCL52_RS12355 (NCL52_12355) spoIITA 2421802..2421981 (-) 180 WP_014480252.1 YqzE family protein -
  NCL52_RS12360 (NCL52_12360) comGG 2422052..2422426 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NCL52_RS12365 (NCL52_12365) comGF 2422427..2422810 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  NCL52_RS12370 (NCL52_12370) comGE 2422836..2423183 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=695382 NCL52_RS12325 WP_003230187.1 2418360..2418533(+) (sinI) [Bacillus subtilis strain N2-10]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=695382 NCL52_RS12325 WP_003230187.1 2418360..2418533(+) (sinI) [Bacillus subtilis strain N2-10]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1