Detailed information NTG0069516

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: BVS141_RS12035
• Genome accession: NZ_AP018402
• Coordinates: 2484008..2484445 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain S141
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2479008..2489445

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BVS141_RS11985 (BVS141_23760)	sinI	2479393..2479566 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
BVS141_RS11990 (BVS141_23770)	sinR	2479600..2479935 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
BVS141_RS11995 (BVS141_23780)	tasA	2479983..2480768 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
BVS141_RS12000 (BVS141_23790)	sipW	2480832..2481416 (-)	585	WP_060562614.1	signal peptidase I SipW	-
BVS141_RS12005 (BVS141_23800)	tapA	2481388..2482059 (-)	672	WP_060562615.1	amyloid fiber anchoring/assembly protein TapA	-
BVS141_RS12010 (BVS141_23810)	-	2482318..2482647 (+)	330	WP_060562616.1	DUF3889 domain-containing protein	-
BVS141_RS12015 (BVS141_23820)	-	2482687..2482866 (-)	180	WP_003153093.1	YqzE family protein	-
BVS141_RS12020 (BVS141_23830)	comGG	2482923..2483300 (-)	378	WP_060562617.1	competence type IV pilus minor pilin ComGG	Machinery gene
BVS141_RS12025 (BVS141_23840)	comGF	2483301..2483801 (-)	501	WP_014305411.1	competence type IV pilus minor pilin ComGF	-
BVS141_RS12030 (BVS141_23850)	comGE	2483710..2484024 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
BVS141_RS12035 (BVS141_23860)	comGD	2484008..2484445 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
BVS141_RS12040 (BVS141_23870)	comGC	2484435..2484701 (-)	267	WP_060562757.1	competence type IV pilus major pilin ComGC	Machinery gene
BVS141_RS12045 (BVS141_23880)	comGB	2484748..2485785 (-)	1038	WP_060562618.1	competence type IV pilus assembly protein ComGB	Machinery gene
BVS141_RS12050 (BVS141_23890)	comGA	2485772..2486842 (-)	1071	WP_007408320.1	competence type IV pilus ATPase ComGA	Machinery gene
BVS141_RS12055 (BVS141_23900)	-	2487035..2487985 (-)	951	WP_119347867.1	magnesium transporter CorA family protein	-
BVS141_RS12060 (BVS141_23910)	-	2488131..2489432 (+)	1302	WP_060562619.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=69516 BVS141_RS12035 WP_012117983.1 2484008..2484445(-) (comGD) [Bacillus velezensis strain S141]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=69516 BVS141_RS12035 WP_012117983.1 2484008..2484445(-) (comGD) [Bacillus velezensis strain S141]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACAACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAATGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572