Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BVS141_RS11985 | Genome accession | NZ_AP018402 |
| Coordinates | 2479393..2479566 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain S141 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2474393..2484566
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVS141_RS11970 (BVS141_23730) | gcvT | 2475210..2476310 (-) | 1101 | WP_015388009.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BVS141_RS11975 (BVS141_23740) | - | 2476734..2478404 (+) | 1671 | WP_060562612.1 | DEAD/DEAH box helicase | - |
| BVS141_RS11980 (BVS141_23750) | - | 2478422..2479216 (+) | 795 | WP_060562613.1 | YqhG family protein | - |
| BVS141_RS11985 (BVS141_23760) | sinI | 2479393..2479566 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BVS141_RS11990 (BVS141_23770) | sinR | 2479600..2479935 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BVS141_RS11995 (BVS141_23780) | tasA | 2479983..2480768 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BVS141_RS12000 (BVS141_23790) | sipW | 2480832..2481416 (-) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| BVS141_RS12005 (BVS141_23800) | tapA | 2481388..2482059 (-) | 672 | WP_060562615.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BVS141_RS12010 (BVS141_23810) | - | 2482318..2482647 (+) | 330 | WP_060562616.1 | DUF3889 domain-containing protein | - |
| BVS141_RS12015 (BVS141_23820) | - | 2482687..2482866 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BVS141_RS12020 (BVS141_23830) | comGG | 2482923..2483300 (-) | 378 | WP_060562617.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BVS141_RS12025 (BVS141_23840) | comGF | 2483301..2483801 (-) | 501 | WP_014305411.1 | competence type IV pilus minor pilin ComGF | - |
| BVS141_RS12030 (BVS141_23850) | comGE | 2483710..2484024 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BVS141_RS12035 (BVS141_23860) | comGD | 2484008..2484445 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=69512 BVS141_RS11985 WP_003153105.1 2479393..2479566(+) (sinI) [Bacillus velezensis strain S141]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=69512 BVS141_RS11985 WP_003153105.1 2479393..2479566(+) (sinI) [Bacillus velezensis strain S141]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |