Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NB636_RS01910 Genome accession   NZ_CP098247
Coordinates   408156..408623 (-) Length   155 a.a.
NCBI ID   WP_269281001.1    Uniprot ID   -
Organism   Oxalobacter aliiformigenes strain BA2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 406912..455607 408156..408623 within 0


Gene organization within MGE regions


Location: 406912..455607
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NB636_RS01905 (NB636_01900) - 406912..407958 (-) 1047 WP_269281003.1 tyrosine-type recombinase/integrase -
  NB636_RS11755 - 407856..408152 (-) 297 WP_416143560.1 helix-turn-helix domain-containing protein -
  NB636_RS01910 (NB636_01905) ssb 408156..408623 (-) 468 WP_269281001.1 single-stranded DNA-binding protein Machinery gene
  NB636_RS01915 (NB636_01910) - 408696..408989 (+) 294 WP_269280998.1 type II toxin-antitoxin system RelE/ParE family toxin -
  NB636_RS01920 (NB636_01915) - 408993..409277 (+) 285 WP_269280996.1 addiction module antidote protein -
  NB636_RS01925 (NB636_01920) - 409514..410557 (-) 1044 WP_269280993.1 recombinase RecT -
  NB636_RS01930 (NB636_01925) - 410568..411470 (-) 903 WP_269280991.1 YqaJ viral recombinase family protein -
  NB636_RS01935 (NB636_01930) - 411470..411637 (-) 168 WP_269280988.1 hypothetical protein -
  NB636_RS01940 (NB636_01935) - 411707..412063 (-) 357 WP_269280985.1 hypothetical protein -
  NB636_RS01945 (NB636_01940) - 412270..412569 (+) 300 WP_269280982.1 ADP-ribosyl-(dinitrogen reductase) hydrolase -
  NB636_RS01950 (NB636_01945) - 412562..412882 (+) 321 WP_269280979.1 hypothetical protein -
  NB636_RS01955 (NB636_01950) - 413268..413918 (-) 651 WP_269280978.1 XRE family transcriptional regulator -
  NB636_RS01960 (NB636_01955) - 414018..414224 (+) 207 WP_269280975.1 helix-turn-helix domain-containing protein -
  NB636_RS01965 (NB636_01960) - 414234..414761 (+) 528 WP_269280972.1 hypothetical protein -
  NB636_RS01970 (NB636_01965) - 414758..415873 (+) 1116 WP_269280970.1 YdaU family protein -
  NB636_RS01975 (NB636_01970) - 415870..416169 (+) 300 WP_269280967.1 hypothetical protein -
  NB636_RS01980 (NB636_01975) - 416157..416582 (+) 426 WP_269280964.1 RusA family crossover junction endodeoxyribonuclease -
  NB636_RS01985 (NB636_01980) - 416576..417064 (+) 489 WP_269280961.1 terminase small subunit -
  NB636_RS01990 (NB636_01985) - 417040..418428 (+) 1389 WP_269280958.1 terminase large subunit domain-containing protein -
  NB636_RS01995 (NB636_01990) - 418432..420345 (+) 1914 WP_269280956.1 hypothetical protein -
  NB636_RS02000 (NB636_01995) - 420354..421373 (+) 1020 WP_269280953.1 hypothetical protein -
  NB636_RS02005 (NB636_02000) - 421467..421751 (-) 285 WP_269280950.1 helix-turn-helix domain-containing protein -
  NB636_RS02010 (NB636_02005) - 421732..422076 (-) 345 WP_269280948.1 type II toxin-antitoxin system RelE/ParE family toxin -
  NB636_RS02015 (NB636_02010) - 422118..422375 (+) 258 WP_269280947.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  NB636_RS02020 (NB636_02015) - 422441..428266 (-) 5826 WP_269295639.1 LPD38 domain-containing protein -
  NB636_RS02025 (NB636_02020) - 428260..433305 (-) 5046 WP_269295640.1 strawberry notch-like NTP hydrolase domain-containing protein -
  NB636_RS02030 (NB636_02025) - 433312..434148 (-) 837 WP_269280941.1 hypothetical protein -
  NB636_RS02035 (NB636_02030) - 434150..434896 (-) 747 WP_269280938.1 hypothetical protein -
  NB636_RS02040 (NB636_02035) - 434899..435831 (-) 933 WP_269280936.1 hypothetical protein -
  NB636_RS02045 (NB636_02040) - 435828..436241 (-) 414 WP_269280933.1 hypothetical protein -
  NB636_RS02050 (NB636_02045) - 436238..437674 (-) 1437 WP_269280931.1 hypothetical protein -
  NB636_RS02055 (NB636_02050) - 437678..438391 (-) 714 WP_269280928.1 hypothetical protein -
  NB636_RS02060 (NB636_02055) - 438625..439674 (+) 1050 WP_269280925.1 phage major capsid protein -
  NB636_RS02065 (NB636_02060) - 439697..440002 (+) 306 WP_269280923.1 hypothetical protein -
  NB636_RS02070 (NB636_02065) - 439980..441698 (+) 1719 WP_269280920.1 hypothetical protein -
  NB636_RS02075 (NB636_02070) - 441695..442294 (+) 600 WP_269295641.1 DUF4376 domain-containing protein -
  NB636_RS02080 (NB636_02075) - 442520..442789 (+) 270 WP_269281307.1 hypothetical protein -
  NB636_RS02085 (NB636_02080) - 442786..443244 (+) 459 WP_269281308.1 lysozyme -
  NB636_RS02090 (NB636_02085) - 443475..443819 (+) 345 WP_269281310.1 hypothetical protein -
  NB636_RS02095 (NB636_02090) - 443822..444613 (+) 792 WP_269281312.1 Rha family transcriptional regulator -
  NB636_RS02100 (NB636_02095) - 444905..445162 (+) 258 WP_269281313.1 hypothetical protein -
  NB636_RS02105 (NB636_02100) - 445508..446386 (+) 879 WP_269281315.1 hypothetical protein -
  NB636_RS02110 (NB636_02105) - 446534..446863 (+) 330 WP_269281316.1 hypothetical protein -
  NB636_RS02115 (NB636_02110) - 447062..447598 (-) 537 WP_269281318.1 hypothetical protein -
  NB636_RS02120 (NB636_02115) - 447651..448553 (-) 903 WP_269281320.1 BRO family protein -
  NB636_RS02125 (NB636_02120) - 449366..449713 (-) 348 WP_269281322.1 hypothetical protein -
  NB636_RS02130 (NB636_02125) - 450780..451316 (+) 537 WP_269281323.1 hypothetical protein -
  NB636_RS02135 (NB636_02130) - 451579..452199 (-) 621 WP_269281325.1 SAM-dependent methyltransferase -
  NB636_RS02140 (NB636_02135) - 452244..453653 (-) 1410 WP_269281327.1 APC family permease -
  NB636_RS02145 (NB636_02140) - 454023..454457 (+) 435 WP_269281329.1 DsbC family protein -
  NB636_RS11760 - 454505..454822 (-) 318 WP_407946888.1 SDR family oxidoreductase -
  NB636_RS02150 (NB636_02145) - 454713..455033 (+) 321 WP_269281330.1 hypothetical protein -
  NB636_RS02155 (NB636_02150) - 455299..455607 (-) 309 WP_269264099.1 DUF1540 domain-containing protein -

Sequence


Protein


Download         Length: 155 a.a.        Molecular weight: 17118.92 Da        Isoelectric Point: 9.2364

>NTDB_id=694668 NB636_RS01910 WP_269281001.1 408156..408623(-) (ssb) [Oxalobacter aliiformigenes strain BA2]
MASVNKVTIIGNLGRDPENRYLPGGEQVTSISVATTENWTDKQSGEKKSLTEWHRISFFGKLAEIAGQYLKKGSPVYVEG
KLRTQKYTDRDGIERYQTNIIASTMQMLGSKQDSGNSGQNGSQNNGRNSYSEAKQTGRRPAPPPAQSDMDDDIPF

Nucleotide


Download         Length: 468 bp        

>NTDB_id=694668 NB636_RS01910 WP_269281001.1 408156..408623(-) (ssb) [Oxalobacter aliiformigenes strain BA2]
ATGGCATCAGTGAATAAAGTCACTATTATTGGAAATTTGGGCCGCGATCCGGAAAACCGGTATTTGCCGGGTGGCGAACA
GGTTACCAGTATTTCGGTAGCCACGACGGAGAACTGGACAGACAAACAGTCCGGTGAGAAAAAATCTCTGACCGAATGGC
ACCGGATTTCCTTTTTCGGCAAACTCGCTGAAATCGCCGGACAGTATCTGAAAAAGGGATCACCGGTCTATGTCGAGGGA
AAACTCCGGACGCAAAAATATACCGACCGTGACGGCATCGAGCGCTACCAGACCAACATCATCGCCAGTACGATGCAAAT
GCTCGGCAGCAAACAGGATAGCGGAAACAGTGGACAGAACGGCAGCCAAAATAATGGACGCAACAGCTACTCCGAAGCCA
AACAGACCGGCAGACGACCGGCACCTCCACCAGCGCAGTCTGATATGGATGATGACATTCCTTTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

45

100

0.523

  ssb Vibrio cholerae strain A1552

44.134

100

0.51

  ssb Neisseria gonorrhoeae MS11

44.828

100

0.503

  ssb Neisseria meningitidis MC58

44.828

100

0.503