Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NB636_RS00975 | Genome accession | NZ_CP098247 |
| Coordinates | 222590..223048 (-) | Length | 152 a.a. |
| NCBI ID | WP_269277652.1 | Uniprot ID | - |
| Organism | Oxalobacter aliiformigenes strain BA2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 219310..264725 | 222590..223048 | within | 0 |
Gene organization within MGE regions
Location: 219310..264725
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB636_RS00960 (NB636_00955) | - | 220551..221471 (-) | 921 | WP_269277644.1 | AEC family transporter | - |
| NB636_RS00965 (NB636_00960) | xth | 221532..222299 (-) | 768 | WP_269277647.1 | exodeoxyribonuclease III | - |
| NB636_RS00975 (NB636_00970) | ssb | 222590..223048 (-) | 459 | WP_269277652.1 | single-stranded DNA-binding protein | Machinery gene |
| NB636_RS00980 (NB636_00975) | - | 223032..223340 (-) | 309 | WP_269277655.1 | hypothetical protein | - |
| NB636_RS00985 (NB636_00980) | - | 223340..223699 (-) | 360 | WP_269277658.1 | Lar family restriction alleviation protein | - |
| NB636_RS00990 (NB636_00985) | - | 223692..223925 (-) | 234 | WP_269277660.1 | hypothetical protein | - |
| NB636_RS00995 (NB636_00990) | - | 224031..224378 (-) | 348 | WP_269277663.1 | hypothetical protein | - |
| NB636_RS01000 (NB636_00995) | - | 224403..225020 (-) | 618 | WP_269277666.1 | hypothetical protein | - |
| NB636_RS01005 (NB636_01000) | - | 225017..225898 (-) | 882 | WP_269277669.1 | ATP-binding protein | - |
| NB636_RS01010 (NB636_01005) | - | 225911..226087 (-) | 177 | WP_269277672.1 | hypothetical protein | - |
| NB636_RS01015 (NB636_01010) | - | 226157..226342 (-) | 186 | WP_269277675.1 | hypothetical protein | - |
| NB636_RS01020 (NB636_01015) | - | 226393..226599 (-) | 207 | WP_269277677.1 | hypothetical protein | - |
| NB636_RS01025 (NB636_01020) | - | 226679..227041 (-) | 363 | WP_269277678.1 | hypothetical protein | - |
| NB636_RS01030 (NB636_01025) | - | 227269..227934 (+) | 666 | WP_269277680.1 | MerR family transcriptional regulator | - |
| NB636_RS01035 (NB636_01030) | - | 227931..228353 (+) | 423 | WP_269277682.1 | DUF5615 family PIN-like protein | - |
| NB636_RS01040 (NB636_01035) | - | 228377..229051 (-) | 675 | WP_269277683.1 | hypothetical protein | - |
| NB636_RS01045 (NB636_01040) | - | 229055..229696 (-) | 642 | WP_269277685.1 | LexA family protein | - |
| NB636_RS01050 (NB636_01045) | - | 229753..229998 (+) | 246 | WP_269277687.1 | transcriptional regulator | - |
| NB636_RS01055 (NB636_01050) | - | 229995..230516 (+) | 522 | WP_269277689.1 | hypothetical protein | - |
| NB636_RS01060 (NB636_01055) | - | 230555..230830 (+) | 276 | WP_269277691.1 | hypothetical protein | - |
| NB636_RS01065 (NB636_01060) | - | 230827..231102 (-) | 276 | WP_269277693.1 | hypothetical protein | - |
| NB636_RS01070 (NB636_01065) | - | 231183..231512 (+) | 330 | WP_269277694.1 | hypothetical protein | - |
| NB636_RS01075 (NB636_01070) | - | 231509..231970 (+) | 462 | WP_269277696.1 | recombination protein NinB | - |
| NB636_RS01080 (NB636_01075) | - | 231967..232266 (+) | 300 | WP_269277698.1 | hypothetical protein | - |
| NB636_RS01085 (NB636_01080) | - | 232263..233618 (+) | 1356 | WP_269295633.1 | DUF6475 domain-containing protein | - |
| NB636_RS01090 (NB636_01085) | - | 233615..233950 (+) | 336 | WP_269277706.1 | hypothetical protein | - |
| NB636_RS01095 (NB636_01090) | - | 233947..234291 (+) | 345 | WP_269277709.1 | DUF1064 domain-containing protein | - |
| NB636_RS01100 (NB636_01095) | - | 234270..234458 (+) | 189 | WP_269277712.1 | hypothetical protein | - |
| NB636_RS11750 | - | 234503..234583 (+) | 81 | WP_407946852.1 | hypothetical protein | - |
| NB636_RS01105 (NB636_01100) | - | 234853..235164 (+) | 312 | WP_269277715.1 | hypothetical protein | - |
| NB636_RS01110 (NB636_01105) | - | 235167..235985 (+) | 819 | WP_269277717.1 | phage antirepressor KilAC domain-containing protein | - |
| NB636_RS01115 (NB636_01110) | - | 236030..236404 (+) | 375 | WP_269277720.1 | terminase small subunit | - |
| NB636_RS01120 (NB636_01115) | - | 236401..237681 (+) | 1281 | WP_269277722.1 | terminase large subunit domain-containing protein | - |
| NB636_RS01125 (NB636_01120) | - | 237678..237944 (-) | 267 | WP_269277725.1 | Txe/YoeB family addiction module toxin | - |
| NB636_RS01130 (NB636_01125) | - | 237937..238209 (-) | 273 | WP_269295634.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| NB636_RS01135 (NB636_01130) | - | 238343..240265 (+) | 1923 | WP_269277731.1 | tail fiber protein | - |
| NB636_RS01140 (NB636_01135) | - | 240262..240894 (+) | 633 | WP_269277733.1 | DUF4376 domain-containing protein | - |
| NB636_RS01145 (NB636_01140) | - | 240878..241141 (+) | 264 | WP_269277735.1 | hypothetical protein | - |
| NB636_RS01150 (NB636_01145) | - | 241119..241427 (+) | 309 | WP_269277738.1 | hypothetical protein | - |
| NB636_RS01155 (NB636_01150) | - | 241427..241927 (+) | 501 | WP_269277741.1 | lysozyme | - |
| NB636_RS01160 (NB636_01155) | - | 241924..242172 (+) | 249 | WP_269277743.1 | hypothetical protein | - |
| NB636_RS01165 (NB636_01160) | nrdD | 242169..242330 (+) | 162 | WP_269277745.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NB636_RS01170 (NB636_01165) | - | 242654..242998 (+) | 345 | WP_269277748.1 | hypothetical protein | - |
| NB636_RS01175 (NB636_01170) | - | 243142..243303 (+) | 162 | WP_269277751.1 | hypothetical protein | - |
| NB636_RS01180 (NB636_01175) | - | 243371..243811 (+) | 441 | WP_269277754.1 | hypothetical protein | - |
| NB636_RS01185 (NB636_01180) | - | 243814..244182 (+) | 369 | WP_269277756.1 | hypothetical protein | - |
| NB636_RS01190 (NB636_01185) | - | 244182..244589 (+) | 408 | WP_269295635.1 | hypothetical protein | - |
| NB636_RS01195 (NB636_01190) | - | 244640..246280 (+) | 1641 | WP_269277762.1 | portal protein | - |
| NB636_RS01200 (NB636_01195) | - | 246273..246539 (+) | 267 | WP_269277765.1 | hypothetical protein | - |
| NB636_RS01205 (NB636_01200) | - | 246536..247144 (+) | 609 | WP_269277767.1 | hypothetical protein | - |
| NB636_RS01210 (NB636_01205) | - | 247177..248175 (+) | 999 | WP_269277770.1 | major capsid protein | - |
| NB636_RS01215 (NB636_01210) | - | 248188..248589 (+) | 402 | WP_269277772.1 | hypothetical protein | - |
| NB636_RS01220 (NB636_01215) | - | 248599..249219 (+) | 621 | WP_269277774.1 | hypothetical protein | - |
| NB636_RS01225 (NB636_01220) | - | 249228..251285 (+) | 2058 | WP_269277776.1 | hypothetical protein | - |
| NB636_RS01230 (NB636_01225) | - | 251287..251934 (+) | 648 | WP_269277778.1 | hypothetical protein | - |
| NB636_RS01235 (NB636_01230) | - | 251934..254024 (+) | 2091 | WP_269277780.1 | transglycosylase SLT domain-containing protein | - |
| NB636_RS01240 (NB636_01235) | - | 254021..261658 (+) | 7638 | WP_269277783.1 | hypothetical protein | - |
| NB636_RS01245 (NB636_01240) | - | 261827..262075 (+) | 249 | WP_269277785.1 | hypothetical protein | - |
| NB636_RS01250 (NB636_01245) | - | 262343..262945 (+) | 603 | WP_269277788.1 | hypothetical protein | - |
| NB636_RS01255 (NB636_01250) | - | 262991..263449 (+) | 459 | WP_269277790.1 | hypothetical protein | - |
| NB636_RS01260 (NB636_01255) | - | 263508..264725 (-) | 1218 | WP_269277792.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 16807.57 Da Isoelectric Point: 9.2488
>NTDB_id=694665 NB636_RS00975 WP_269277652.1 222590..223048(-) (ssb) [Oxalobacter aliiformigenes strain BA2]
MASVNKVIIVGNLGRDPENRYLPSGEQVTSIAVATTENWTDKQTGGQKSLTEWHRISFFGKLAEIAGQYLKKGSPVYVEG
KLRTQKYTDRDGIERYQTNIIASTMQMLGSKQDSGNSGQNGSQNNGRNSYSEAKQTGRRPTTQADLDDDIPF
MASVNKVIIVGNLGRDPENRYLPSGEQVTSIAVATTENWTDKQTGGQKSLTEWHRISFFGKLAEIAGQYLKKGSPVYVEG
KLRTQKYTDRDGIERYQTNIIASTMQMLGSKQDSGNSGQNGSQNNGRNSYSEAKQTGRRPTTQADLDDDIPF
Nucleotide
Download Length: 459 bp
>NTDB_id=694665 NB636_RS00975 WP_269277652.1 222590..223048(-) (ssb) [Oxalobacter aliiformigenes strain BA2]
ATGGCATCAGTAAATAAAGTCATCATTGTCGGCAATCTCGGCCGCGATCCGGAAAACCGATATCTGCCGAGCGGCGAACA
GGTGACCAGTATTGCGGTAGCCACGACGGAGAACTGGACAGACAAACAGACCGGCGGGCAAAAAAGCCTGACCGAATGGC
ACCGTATTTCCTTTTTCGGGAAGCTGGCGGAAATTGCCGGACAGTATCTGAAAAAAGGATCACCGGTCTATGTCGAAGGA
AAACTCCGGACGCAAAAATATACCGACCGTGACGGCATCGAGCGTTATCAGACCAACATCATCGCCAGTACGATGCAGAT
GCTCGGCAGCAAACAGGATAGCGGAAACAGTGGACAGAACGGCAGCCAAAATAATGGACGCAACAGCTACTCCGAAGCCA
AACAGACCGGCAGACGACCAACAACACAAGCGGATTTAGATGACGATATCCCTTTCTAG
ATGGCATCAGTAAATAAAGTCATCATTGTCGGCAATCTCGGCCGCGATCCGGAAAACCGATATCTGCCGAGCGGCGAACA
GGTGACCAGTATTGCGGTAGCCACGACGGAGAACTGGACAGACAAACAGACCGGCGGGCAAAAAAGCCTGACCGAATGGC
ACCGTATTTCCTTTTTCGGGAAGCTGGCGGAAATTGCCGGACAGTATCTGAAAAAAGGATCACCGGTCTATGTCGAAGGA
AAACTCCGGACGCAAAAATATACCGACCGTGACGGCATCGAGCGTTATCAGACCAACATCATCGCCAGTACGATGCAGAT
GCTCGGCAGCAAACAGGATAGCGGAAACAGTGGACAGAACGGCAGCCAAAATAATGGACGCAACAGCTACTCCGAAGCCA
AACAGACCGGCAGACGACCAACAACACAAGCGGATTTAGATGACGATATCCCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
45.556 |
100 |
0.539 |
| ssb | Vibrio cholerae strain A1552 |
45.198 |
100 |
0.526 |
| ssb | Neisseria meningitidis MC58 |
42.529 |
100 |
0.487 |
| ssb | Neisseria gonorrhoeae MS11 |
42.529 |
100 |
0.487 |