Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   NB639_RS01155 Genome accession   NZ_CP098244
Coordinates   266720..267166 (-) Length   148 a.a.
NCBI ID   WP_269307527.1    Uniprot ID   -
Organism   Oxalobacter formigenes strain OxWR1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 265389..306705 266720..267166 within 0


Gene organization within MGE regions


Location: 265389..306705
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NB639_RS01150 (NB639_01150) - 265389..266546 (-) 1158 WP_269307526.1 site-specific integrase -
  NB639_RS01155 (NB639_01155) ssb 266720..267166 (-) 447 WP_269307527.1 single-stranded DNA-binding protein Machinery gene
  NB639_RS01160 (NB639_01160) - 267169..267654 (-) 486 WP_005879624.1 class I SAM-dependent methyltransferase -
  NB639_RS01165 (NB639_01165) - 267642..267890 (-) 249 WP_005879626.1 hypothetical protein -
  NB639_RS01170 (NB639_01170) - 267887..268186 (-) 300 WP_050757684.1 hypothetical protein -
  NB639_RS01175 (NB639_01175) - 268183..268623 (-) 441 WP_036602509.1 hypothetical protein -
  NB639_RS01180 (NB639_01180) - 268620..269135 (-) 516 WP_036602512.1 hypothetical protein -
  NB639_RS01185 (NB639_01185) - 269116..269328 (-) 213 WP_157661019.1 hypothetical protein -
  NB639_RS01190 (NB639_01190) - 269514..270146 (-) 633 WP_269307528.1 hypothetical protein -
  NB639_RS01195 (NB639_01195) - 270426..270902 (-) 477 WP_269307529.1 hypothetical protein -
  NB639_RS01200 (NB639_01200) - 271049..271897 (-) 849 WP_269307530.1 recombinase RecT -
  NB639_RS01205 (NB639_01205) - 271900..272727 (-) 828 WP_269307531.1 DUF1351 domain-containing protein -
  NB639_RS01210 (NB639_01210) - 272731..273369 (-) 639 WP_269307532.1 YqaJ viral recombinase family protein -
  NB639_RS01215 (NB639_01215) - 273366..273569 (-) 204 WP_269307533.1 hypothetical protein -
  NB639_RS01220 (NB639_01220) - 273600..273770 (-) 171 WP_269307534.1 hypothetical protein -
  NB639_RS01225 (NB639_01225) - 273767..273967 (-) 201 WP_269307535.1 hypothetical protein -
  NB639_RS01230 (NB639_01230) - 273964..274362 (-) 399 WP_269307536.1 hypothetical protein -
  NB639_RS01235 (NB639_01235) - 274373..274939 (-) 567 WP_269307537.1 LPD29 domain-containing protein -
  NB639_RS01240 (NB639_01240) - 275112..275414 (-) 303 WP_269307538.1 STAS-like domain-containing protein -
  NB639_RS01245 (NB639_01245) - 275395..276252 (-) 858 WP_269307539.1 ATP-binding protein -
  NB639_RS01250 (NB639_01250) - 276710..277114 (-) 405 WP_269307540.1 hypothetical protein -
  NB639_RS01255 (NB639_01255) - 277628..278332 (-) 705 WP_269307541.1 XRE family transcriptional regulator -
  NB639_RS01260 (NB639_01260) - 278382..278636 (+) 255 WP_269307871.1 helix-turn-helix domain-containing protein -
  NB639_RS01265 (NB639_01265) - 278633..279079 (+) 447 WP_269307542.1 YmfL family putative regulatory protein -
  NB639_RS01270 (NB639_01270) - 279175..279336 (+) 162 WP_269307543.1 hypothetical protein -
  NB639_RS01275 (NB639_01275) - 279512..280435 (+) 924 WP_269307544.1 YdaU family protein -
  NB639_RS01280 (NB639_01280) - 280432..280590 (+) 159 WP_269307545.1 ribbon-helix-helix domain-containing protein -
  NB639_RS01285 (NB639_01285) - 280587..280838 (+) 252 WP_269307546.1 hypothetical protein -
  NB639_RS01290 (NB639_01290) - 280831..281172 (+) 342 WP_269307547.1 DUF1064 domain-containing protein -
  NB639_RS01295 (NB639_01295) - 281187..281354 (+) 168 WP_269307548.1 hypothetical protein -
  NB639_RS11210 - 281351..281536 (+) 186 WP_416143472.1 helix-turn-helix domain-containing protein -
  NB639_RS01300 (NB639_01300) - 281569..282054 (+) 486 WP_269307549.1 terminase small subunit -
  NB639_RS01305 (NB639_01305) - 282072..283427 (+) 1356 WP_269307550.1 terminase -
  NB639_RS01310 (NB639_01310) - 283424..285313 (+) 1890 WP_269307551.1 hypothetical protein -
  NB639_RS01315 (NB639_01315) - 285317..286372 (+) 1056 WP_269307552.1 hypothetical protein -
  NB639_RS01320 (NB639_01320) - 286651..287700 (+) 1050 WP_269307553.1 phage major capsid protein -
  NB639_RS01325 (NB639_01325) - 287761..288114 (+) 354 WP_269307554.1 hypothetical protein -
  NB639_RS01330 (NB639_01330) - 288118..289302 (+) 1185 WP_269307555.1 phage tail protein -
  NB639_RS01335 (NB639_01335) - 289299..289826 (+) 528 WP_269307556.1 DUF4376 domain-containing protein -
  NB639_RS01340 (NB639_01340) - 289810..290055 (+) 246 WP_269307557.1 hypothetical protein -
  NB639_RS01345 (NB639_01345) - 290052..290309 (+) 258 WP_050757687.1 hypothetical protein -
  NB639_RS01350 (NB639_01350) - 290312..290779 (+) 468 WP_269307558.1 lysozyme -
  NB639_RS01355 (NB639_01355) - 290776..291126 (+) 351 WP_269307559.1 hypothetical protein -
  NB639_RS01360 (NB639_01360) - 291379..291966 (+) 588 WP_269307560.1 hypothetical protein -
  NB639_RS01365 (NB639_01365) - 291970..293403 (+) 1434 WP_269307561.1 hypothetical protein -
  NB639_RS01370 (NB639_01370) - 293400..293840 (+) 441 WP_269307562.1 hypothetical protein -
  NB639_RS01375 (NB639_01375) - 293837..294769 (+) 933 WP_269307563.1 hypothetical protein -
  NB639_RS01380 (NB639_01380) - 294772..295470 (+) 699 WP_269307564.1 hypothetical protein -
  NB639_RS01385 (NB639_01385) - 295475..296320 (+) 846 WP_269307565.1 hypothetical protein -
  NB639_RS01390 (NB639_01390) - 296323..303438 (+) 7116 WP_269307566.1 LPD38 domain-containing protein -
  NB639_RS01395 (NB639_01395) - 303598..303954 (+) 357 WP_269307567.1 LexA family protein -
  NB639_RS01400 (NB639_01400) - 304140..304517 (+) 378 WP_269307568.1 hypothetical protein -
  NB639_RS01405 (NB639_01405) - 304652..304924 (-) 273 WP_269307569.1 type II toxin-antitoxin system YafQ family toxin -
  NB639_RS01410 (NB639_01410) - 304924..305205 (-) 282 WP_269307570.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  NB639_RS01415 (NB639_01415) - 305611..305814 (+) 204 WP_036602565.1 cold-shock protein -
  NB639_RS01420 (NB639_01420) - 305872..306057 (+) 186 WP_036602567.1 hypothetical protein -
  NB639_RS01425 (NB639_01425) - 306388..306705 (+) 318 WP_269307571.1 transcriptional regulator -

Sequence

Protein


Download         Length: 148 a.a.        Molecular weight: 16652.61 Da        Isoelectric Point: 5.9567

>NTDB_id=694623 NB639_RS01155 WP_269307527.1 266720..267166(-) (ssb) [Oxalobacter formigenes strain OxWR1]
MASINKVILIGNLGRDPENRYLPSGEQVTSIAVATTESWKDKTTGEKQSLTEWHRISFFGKLAEIAGQYLKKGSQVYIEG
RLRTRKYTDKEGIDRYATEIIADTMQMLGSRQDGQESTGRNKYAEQTGRDAPSQRPAPMSDMDDDIPF

Nucleotide


Download         Length: 447 bp        

>NTDB_id=694623 NB639_RS01155 WP_269307527.1 266720..267166(-) (ssb) [Oxalobacter formigenes strain OxWR1]
ATGGCATCAATAAACAAGGTAATTCTCATAGGCAACTTGGGCCGTGACCCAGAAAATCGCTATTTGCCCAGTGGTGAACA
GGTGACCAGTATTGCAGTTGCGACAACAGAAAGCTGGAAAGATAAAACTACCGGCGAGAAACAAAGCCTGACCGAATGGC
ATCGCATTTCCTTCTTCGGCAAACTGGCTGAAATTGCAGGACAGTACCTGAAAAAGGGTTCACAGGTCTATATCGAAGGC
CGTCTGAGAACGCGTAAATATACCGACAAGGAAGGCATCGACCGTTACGCGACCGAAATCATCGCCGACACTATGCAGAT
GCTTGGCAGCCGTCAGGATGGGCAGGAAAGCACTGGGCGCAATAAATATGCGGAACAAACAGGCAGAGACGCGCCAAGTC
AGCGCCCTGCTCCTATGTCTGATATGGACGACGATATCCCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

49.718

100

0.595
  ssb Glaesserella parasuis strain SC1401

47.222

100

0.574
  ssb Neisseria meningitidis MC58

47.701

100

0.561
  ssb Neisseria gonorrhoeae MS11

47.701

100

0.561