Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M9417_RS01385 | Genome accession | NZ_CP097793 |
| Coordinates | 280507..280959 (+) | Length | 150 a.a. |
| NCBI ID | WP_099803107.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 21275 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 225182..284821 | 280507..280959 | within | 0 |
Gene organization within MGE regions
Location: 225182..284821
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9417_RS01040 (M9417_01040) | - | 225182..225652 (+) | 471 | WP_014390768.1 | FxsA family protein | - |
| M9417_RS01045 (M9417_01045) | - | 225741..226031 (+) | 291 | WP_005717461.1 | co-chaperone GroES | - |
| M9417_RS01050 (M9417_01050) | groL | 226127..227770 (+) | 1644 | WP_005717462.1 | chaperonin GroEL | - |
| M9417_RS01055 (M9417_01055) | modA | 227905..228642 (+) | 738 | WP_005723309.1 | molybdate ABC transporter substrate-binding protein | - |
| M9417_RS01060 (M9417_01060) | - | 228617..229414 (+) | 798 | WP_041423053.1 | ABC transporter permease | - |
| M9417_RS01065 (M9417_01065) | - | 229416..230015 (+) | 600 | WP_005723312.1 | ATP-binding cassette domain-containing protein | - |
| M9417_RS01070 (M9417_01070) | modD | 230033..230881 (+) | 849 | WP_014390766.1 | ModD protein | - |
| M9417_RS01075 (M9417_01075) | - | 230981..232813 (-) | 1833 | WP_014390765.1 | DEAD/DEAH box helicase | - |
| M9417_RS01080 (M9417_01080) | nlpI | 232921..233817 (-) | 897 | WP_010907022.1 | lipoprotein NlpI | - |
| M9417_RS01085 (M9417_01085) | pnp | 233901..236045 (-) | 2145 | WP_079157785.1 | polyribonucleotide nucleotidyltransferase | - |
| M9417_RS01090 (M9417_01090) | - | 236731..237243 (+) | 513 | WP_014390763.1 | hypothetical protein | - |
| M9417_RS01095 (M9417_01095) | - | 237243..237989 (+) | 747 | WP_014390762.1 | hypothetical protein | - |
| M9417_RS01100 (M9417_01100) | - | 238380..238703 (-) | 324 | WP_014390761.1 | hypothetical protein | - |
| M9417_RS01105 (M9417_01105) | - | 238751..243520 (-) | 4770 | WP_250264889.1 | phage tail protein | - |
| M9417_RS01110 (M9417_01110) | - | 243757..244380 (-) | 624 | WP_078819659.1 | tail assembly protein | - |
| M9417_RS01115 (M9417_01115) | - | 244323..245066 (-) | 744 | WP_079157783.1 | C40 family peptidase | - |
| M9417_RS01120 (M9417_01120) | - | 245070..245783 (-) | 714 | WP_079157782.1 | phage minor tail protein L | - |
| M9417_RS01125 (M9417_01125) | - | 246072..246422 (-) | 351 | WP_005719622.1 | phage tail protein | - |
| M9417_RS01130 (M9417_01130) | - | 246419..248812 (-) | 2394 | WP_170356808.1 | phage tail length tape measure family protein | - |
| M9417_RS01135 (M9417_01135) | - | 248799..249104 (-) | 306 | WP_306556893.1 | phage tail assembly protein T | - |
| M9417_RS01140 (M9417_01140) | - | 249122..249511 (-) | 390 | WP_014391488.1 | phage minor tail protein G | - |
| M9417_RS01145 (M9417_01145) | - | 249514..250023 (-) | 510 | WP_014391487.1 | phage tail tube protein | - |
| M9417_RS01150 (M9417_01150) | gpU | 250020..250427 (-) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| M9417_RS01155 (M9417_01155) | - | 250424..250975 (-) | 552 | WP_170356810.1 | phage tail protein | - |
| M9417_RS01160 (M9417_01160) | - | 250975..251268 (-) | 294 | WP_005719722.1 | hypothetical protein | - |
| M9417_RS01165 (M9417_01165) | - | 251261..251587 (-) | 327 | WP_016570083.1 | capsid cement protein | - |
| M9417_RS01170 (M9417_01170) | - | 251660..253687 (-) | 2028 | WP_170356812.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| M9417_RS01175 (M9417_01175) | - | 253620..255161 (-) | 1542 | WP_170356815.1 | phage portal protein | - |
| M9417_RS01180 (M9417_01180) | - | 255158..255385 (-) | 228 | WP_240962717.1 | hypothetical protein | - |
| M9417_RS01185 (M9417_01185) | - | 255376..257484 (-) | 2109 | WP_170356818.1 | phage terminase large subunit family protein | - |
| M9417_RS01190 (M9417_01190) | - | 257488..257961 (-) | 474 | WP_170356821.1 | DUF1441 family protein | - |
| M9417_RS01195 (M9417_01195) | - | 258251..258511 (+) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M9417_RS01200 (M9417_01200) | - | 258547..258915 (+) | 369 | WP_014391478.1 | helix-turn-helix transcriptional regulator | - |
| M9417_RS01205 (M9417_01205) | - | 259125..259481 (-) | 357 | WP_234514998.1 | DUF2570 family protein | - |
| M9417_RS01210 (M9417_01210) | - | 259438..259851 (-) | 414 | WP_079157772.1 | M15 family metallopeptidase | - |
| M9417_RS01215 (M9417_01215) | - | 259844..260206 (-) | 363 | WP_079157771.1 | phage holin, lambda family | - |
| M9417_RS01220 (M9417_01220) | - | 260323..260880 (+) | 558 | WP_079157770.1 | hypothetical protein | - |
| M9417_RS01225 (M9417_01225) | - | 261007..261624 (-) | 618 | WP_250264890.1 | KilA-N domain-containing protein | - |
| M9417_RS01230 (M9417_01230) | - | 262114..262614 (-) | 501 | WP_079157768.1 | hypothetical protein | - |
| M9417_RS01235 (M9417_01235) | - | 262714..263079 (-) | 366 | WP_099821838.1 | antiterminator Q family protein | - |
| M9417_RS01240 (M9417_01240) | - | 263079..263681 (-) | 603 | WP_099821839.1 | recombination protein NinG | - |
| M9417_RS01245 (M9417_01245) | - | 263674..263889 (-) | 216 | WP_014390727.1 | hypothetical protein | - |
| M9417_RS01250 (M9417_01250) | - | 263963..264613 (-) | 651 | WP_170353044.1 | metallophosphoesterase | - |
| M9417_RS01255 (M9417_01255) | - | 264698..265135 (-) | 438 | WP_064965060.1 | DUF1367 family protein | - |
| M9417_RS01260 (M9417_01260) | - | 265144..265674 (-) | 531 | WP_170356878.1 | MT-A70 family methyltransferase | - |
| M9417_RS01265 (M9417_01265) | - | 265667..266362 (-) | 696 | WP_250264906.1 | replication protein P | - |
| M9417_RS01270 (M9417_01270) | - | 266362..267261 (-) | 900 | WP_014390723.1 | hypothetical protein | - |
| M9417_RS01275 (M9417_01275) | - | 267263..267616 (-) | 354 | WP_014390722.1 | HNH endonuclease signature motif containing protein | - |
| M9417_RS01280 (M9417_01280) | - | 267613..268296 (-) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| M9417_RS01285 (M9417_01285) | - | 268354..268803 (-) | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| M9417_RS01290 (M9417_01290) | - | 268852..269052 (-) | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| M9417_RS01295 (M9417_01295) | - | 269177..269860 (+) | 684 | WP_099821842.1 | S24 family peptidase | - |
| M9417_RS01300 (M9417_01300) | - | 269932..270852 (+) | 921 | WP_079157963.1 | hypothetical protein | - |
| M9417_RS01305 (M9417_01305) | - | 271000..272934 (-) | 1935 | WP_079157962.1 | ATP-binding protein | - |
| M9417_RS01310 (M9417_01310) | - | 273455..273685 (+) | 231 | WP_079157961.1 | hypothetical protein | - |
| M9417_RS01315 (M9417_01315) | - | 273698..273868 (+) | 171 | WP_014391460.1 | hypothetical protein | - |
| M9417_RS01320 (M9417_01320) | - | 273849..274043 (-) | 195 | WP_014391459.1 | hypothetical protein | - |
| M9417_RS01325 (M9417_01325) | - | 274340..274528 (+) | 189 | WP_014391458.1 | hypothetical protein | - |
| M9417_RS01330 (M9417_01330) | - | 274521..274793 (-) | 273 | WP_014391457.1 | hypothetical protein | - |
| M9417_RS01335 (M9417_01335) | - | 274971..275351 (+) | 381 | WP_075271374.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M9417_RS01340 (M9417_01340) | - | 275570..275833 (+) | 264 | WP_071522857.1 | hypothetical protein | - |
| M9417_RS01345 (M9417_01345) | - | 275921..276718 (+) | 798 | WP_064964923.1 | hypothetical protein | - |
| M9417_RS01350 (M9417_01350) | - | 277048..277659 (+) | 612 | WP_250264891.1 | antA/AntB antirepressor family protein | - |
| M9417_RS01355 (M9417_01355) | - | 277721..277951 (-) | 231 | WP_223251317.1 | hypothetical protein | - |
| M9417_RS01360 (M9417_01360) | - | 278099..278398 (+) | 300 | WP_014390709.1 | hypothetical protein | - |
| M9417_RS01365 (M9417_01365) | - | 278370..278606 (+) | 237 | WP_170356872.1 | hypothetical protein | - |
| M9417_RS01370 (M9417_01370) | - | 278619..278906 (+) | 288 | WP_014391452.1 | hypothetical protein | - |
| M9417_RS01375 (M9417_01375) | - | 278908..279861 (+) | 954 | WP_014391451.1 | recombinase RecT | - |
| M9417_RS01380 (M9417_01380) | - | 279848..280507 (+) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| M9417_RS01385 (M9417_01385) | ssb | 280507..280959 (+) | 453 | WP_099803107.1 | single-stranded DNA-binding protein | Machinery gene |
| M9417_RS01390 (M9417_01390) | - | 281032..281385 (+) | 354 | WP_016570064.1 | hypothetical protein | - |
| M9417_RS01395 (M9417_01395) | - | 281457..282245 (+) | 789 | WP_064964852.1 | DUF2303 family protein | - |
| M9417_RS01400 (M9417_01400) | - | 282296..282895 (+) | 600 | WP_014391447.1 | hypothetical protein | - |
| M9417_RS01405 (M9417_01405) | - | 283029..283526 (+) | 498 | WP_170356874.1 | DUF551 domain-containing protein | - |
| M9417_RS01410 (M9417_01410) | - | 283535..283888 (+) | 354 | WP_078819897.1 | hypothetical protein | - |
| M9417_RS01415 (M9417_01415) | - | 284147..284365 (+) | 219 | WP_005720317.1 | hypothetical protein | - |
| M9417_RS01420 (M9417_01420) | - | 284379..284594 (+) | 216 | WP_250264892.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16887.72 Da Isoelectric Point: 6.9828
>NTDB_id=692544 M9417_RS01385 WP_099803107.1 280507..280959(+) (ssb) [Pasteurella multocida strain 21275]
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQAPQNNAYANAKAGKPVQQADNFEEDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQAPQNNAYANAKAGKPVQQADNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=692544 M9417_RS01385 WP_099803107.1 280507..280959(+) (ssb) [Pasteurella multocida strain 21275]
ATGGCTGGAGTAAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGAATGCGAAAGCTG
GAAAGCCAGTGCAGCAAGCAGATAACTTTGAAGAGGATAATATCCCGTTCTGA
ATGGCTGGAGTAAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGAATGCGAAAGCTG
GAAAGCCAGTGCAGCAAGCAGATAACTTTGAAGAGGATAATATCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.431 |
100 |
0.753 |
| ssb | Vibrio cholerae strain A1552 |
52.74 |
97.333 |
0.513 |
| ssb | Neisseria gonorrhoeae MS11 |
46.043 |
92.667 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
46.043 |
92.667 |
0.427 |