Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M9411_RS09555 | Genome accession | NZ_CP097787 |
| Coordinates | 2026126..2026575 (-) | Length | 149 a.a. |
| NCBI ID | WP_250251964.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 38725 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2020894..2064643 | 2026126..2026575 | within | 0 |
Gene organization within MGE regions
Location: 2020894..2064643
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9411_RS09520 (M9411_09520) | - | 2020894..2021925 (-) | 1032 | WP_250251953.1 | tyrosine-type recombinase/integrase | - |
| M9411_RS09525 (M9411_09525) | - | 2021927..2022178 (-) | 252 | WP_250251955.1 | DUF4224 domain-containing protein | - |
| M9411_RS09530 (M9411_09530) | - | 2022214..2022528 (-) | 315 | WP_250251957.1 | hypothetical protein | - |
| M9411_RS09535 (M9411_09535) | - | 2022533..2023003 (-) | 471 | WP_250251959.1 | pyruvate kinase | - |
| M9411_RS09540 (M9411_09540) | - | 2023109..2023777 (-) | 669 | WP_250251960.1 | P22AR C-terminal domain-containing protein | - |
| M9411_RS09545 (M9411_09545) | - | 2024064..2024891 (-) | 828 | WP_012341685.1 | BRO family protein | - |
| M9411_RS09550 (M9411_09550) | - | 2025232..2026044 (+) | 813 | WP_250251962.1 | hypothetical protein | - |
| M9411_RS09555 (M9411_09555) | ssb | 2026126..2026575 (-) | 450 | WP_250251964.1 | single-stranded DNA-binding protein | Machinery gene |
| M9411_RS09560 (M9411_09560) | - | 2026586..2027287 (-) | 702 | WP_250251966.1 | ERF family protein | - |
| M9411_RS09565 (M9411_09565) | - | 2027330..2027974 (-) | 645 | WP_250251967.1 | ribonuclease H-like domain-containing protein | - |
| M9411_RS09570 (M9411_09570) | - | 2028126..2028308 (-) | 183 | WP_250251969.1 | hypothetical protein | - |
| M9411_RS09575 (M9411_09575) | - | 2028545..2028826 (-) | 282 | WP_250251972.1 | hypothetical protein | - |
| M9411_RS09580 (M9411_09580) | - | 2029344..2029880 (+) | 537 | WP_061406092.1 | hypothetical protein | - |
| M9411_RS09585 (M9411_09585) | - | 2030215..2030760 (-) | 546 | WP_250251973.1 | hypothetical protein | - |
| M9411_RS09590 (M9411_09590) | - | 2030797..2031759 (-) | 963 | WP_250251974.1 | hypothetical protein | - |
| M9411_RS09595 (M9411_09595) | - | 2031832..2032521 (-) | 690 | WP_250251975.1 | helix-turn-helix transcriptional regulator | - |
| M9411_RS09600 (M9411_09600) | - | 2032643..2032843 (+) | 201 | WP_099803112.1 | YdaS family helix-turn-helix protein | - |
| M9411_RS09605 (M9411_09605) | - | 2032892..2033344 (+) | 453 | WP_250251976.1 | phage regulatory CII family protein | - |
| M9411_RS09610 (M9411_09610) | - | 2033581..2034645 (+) | 1065 | WP_250251979.1 | replication protein | - |
| M9411_RS09615 (M9411_09615) | - | 2034645..2036081 (+) | 1437 | WP_250251981.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M9411_RS09620 (M9411_09620) | - | 2036085..2036510 (+) | 426 | WP_250251983.1 | recombination protein NinB | - |
| M9411_RS09625 (M9411_09625) | - | 2036605..2036832 (+) | 228 | WP_250251985.1 | hypothetical protein | - |
| M9411_RS09630 (M9411_09630) | - | 2037233..2037829 (+) | 597 | WP_250251986.1 | recombination protein NinG | - |
| M9411_RS09635 (M9411_09635) | - | 2037831..2038292 (+) | 462 | WP_250251988.1 | antiterminator Q family protein | - |
| M9411_RS09645 (M9411_09645) | - | 2038619..2038984 (+) | 366 | WP_032854011.1 | phage holin, lambda family | - |
| M9411_RS09650 (M9411_09650) | - | 2038956..2039540 (+) | 585 | WP_250251989.1 | glycoside hydrolase family 19 protein | - |
| M9411_RS09655 (M9411_09655) | - | 2039543..2039866 (+) | 324 | WP_250251991.1 | DUF2570 family protein | - |
| M9411_RS09660 (M9411_09660) | - | 2040040..2040372 (+) | 333 | WP_250251993.1 | HNH endonuclease signature motif containing protein | - |
| M9411_RS09665 (M9411_09665) | - | 2040470..2040922 (+) | 453 | WP_250251995.1 | hypothetical protein | - |
| M9411_RS09670 (M9411_09670) | - | 2040922..2042433 (+) | 1512 | WP_250251997.1 | terminase TerL endonuclease subunit | - |
| M9411_RS09675 (M9411_09675) | - | 2042430..2043665 (+) | 1236 | WP_250251999.1 | phage portal protein | - |
| M9411_RS09680 (M9411_09680) | - | 2043655..2044314 (+) | 660 | WP_250252001.1 | HK97 family phage prohead protease | - |
| M9411_RS09685 (M9411_09685) | - | 2044317..2045513 (+) | 1197 | WP_250252002.1 | phage major capsid protein | - |
| M9411_RS09690 (M9411_09690) | - | 2045560..2045874 (+) | 315 | WP_250252004.1 | head-tail connector protein | - |
| M9411_RS09695 (M9411_09695) | - | 2045874..2046197 (+) | 324 | WP_250252006.1 | phage head closure protein | - |
| M9411_RS09700 (M9411_09700) | - | 2046190..2046672 (+) | 483 | WP_250252008.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M9411_RS09705 (M9411_09705) | - | 2046669..2047013 (+) | 345 | WP_250252010.1 | DUF3168 domain-containing protein | - |
| M9411_RS09710 (M9411_09710) | - | 2047016..2047669 (+) | 654 | WP_250252644.1 | hypothetical protein | - |
| M9411_RS09715 (M9411_09715) | - | 2047724..2048116 (+) | 393 | WP_250252012.1 | hypothetical protein | - |
| M9411_RS09720 (M9411_09720) | - | 2048185..2048412 (+) | 228 | WP_250252014.1 | DUF4035 domain-containing protein | - |
| M9411_RS09725 (M9411_09725) | - | 2048486..2048821 (+) | 336 | WP_250252016.1 | hypothetical protein | - |
| M9411_RS09730 (M9411_09730) | - | 2048848..2049192 (+) | 345 | WP_250252018.1 | hypothetical protein | - |
| M9411_RS09735 (M9411_09735) | - | 2049220..2049786 (+) | 567 | WP_250252020.1 | hypothetical protein | - |
| M9411_RS09740 (M9411_09740) | - | 2049890..2050861 (-) | 972 | WP_005756570.1 | P63C domain-containing protein | - |
| M9411_RS09745 (M9411_09745) | - | 2051234..2052064 (+) | 831 | WP_250252022.1 | phage antirepressor N-terminal domain-containing protein | - |
| M9411_RS09750 (M9411_09750) | - | 2052119..2052475 (+) | 357 | WP_250252024.1 | DUF2513 domain-containing protein | - |
| M9411_RS09755 (M9411_09755) | - | 2052534..2052785 (+) | 252 | WP_250252026.1 | hypothetical protein | - |
| M9411_RS09760 (M9411_09760) | - | 2052843..2056130 (+) | 3288 | WP_250252027.1 | tape measure protein | - |
| M9411_RS09765 (M9411_09765) | - | 2056127..2056555 (+) | 429 | WP_250252028.1 | phage tail protein | - |
| M9411_RS09770 (M9411_09770) | - | 2056548..2057315 (+) | 768 | WP_250252652.1 | collagen-like protein | - |
| M9411_RS09775 (M9411_09775) | - | 2057325..2057909 (+) | 585 | WP_250252029.1 | DUF4376 domain-containing protein | - |
| M9411_RS09780 (M9411_09780) | - | 2057896..2058162 (+) | 267 | WP_115322736.1 | DNA helicase UvrD | - |
| M9411_RS09785 (M9411_09785) | - | 2058171..2058884 (+) | 714 | WP_250252030.1 | phage minor tail protein L | - |
| M9411_RS09790 (M9411_09790) | - | 2058887..2059621 (+) | 735 | WP_250252031.1 | C40 family peptidase | - |
| M9411_RS09795 (M9411_09795) | - | 2059564..2060187 (+) | 624 | WP_250252033.1 | tail assembly protein | - |
| M9411_RS09800 (M9411_09800) | - | 2060191..2063532 (+) | 3342 | WP_250252034.1 | phage tail protein | - |
| M9411_RS09805 (M9411_09805) | - | 2063801..2064643 (-) | 843 | WP_005726500.1 | patatin family protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16837.57 Da Isoelectric Point: 5.9108
>NTDB_id=692428 M9411_RS09555 WP_250251964.1 2026126..2026575(-) (ssb) [Pasteurella multocida strain 38725]
MAGVNRVIILGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAQAPQNNAYASAKSGNPVQQQSDNFEEDSIPF
MAGVNRVIILGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAQAPQNNAYASAKSGNPVQQQSDNFEEDSIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=692428 M9411_RS09555 WP_250251964.1 2026126..2026575(-) (ssb) [Pasteurella multocida strain 38725]
ATGGCTGGGGTTAATCGTGTAATTATTTTGGGAAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTAGCAAAAATCAGTGTTGCAACCAGTGAAAGCTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTCTATGTTGAAGGT
CGTTTAAAAACTCGCAAATGGCAAGATCAAAATGGGCAAGACCGCTACACTACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAACCGCAGGCACAAGCACCACAAAACAATGCTTATGCTAGTGCGAAAAGTGGAAATC
CAGTACAGCAACAGTCAGATAATTTTGAAGAAGACAGCATACCTTTTTAG
ATGGCTGGGGTTAATCGTGTAATTATTTTGGGAAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTAGCAAAAATCAGTGTTGCAACCAGTGAAAGCTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTCTATGTTGAAGGT
CGTTTAAAAACTCGCAAATGGCAAGATCAAAATGGGCAAGACCGCTACACTACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAACCGCAGGCACAAGCACCACAAAACAATGCTTATGCTAGTGCGAAAAGTGGAAATC
CAGTACAGCAACAGTCAGATAATTTTGAAGAAGACAGCATACCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
84.685 |
74.497 |
0.631 |
| ssb | Vibrio cholerae strain A1552 |
60.177 |
75.839 |
0.456 |
| ssb | Neisseria gonorrhoeae MS11 |
46.324 |
91.275 |
0.423 |
| ssb | Neisseria meningitidis MC58 |
46.324 |
91.275 |
0.423 |