Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   MF628_RS04760 Genome accession   NZ_CP097767
Coordinates   1025276..1025710 (-) Length   144 a.a.
NCBI ID   WP_250272470.1    Uniprot ID   -
Organism   Paenibacillus polymyxa strain R 5.31     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 985616..1032460 1025276..1025710 within 0


Gene organization within MGE regions


Location: 985616..1032460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF628_RS04445 (MF628_000889) - 985655..986545 (+) 891 WP_250272417.1 DUF6414 family protein -
  MF628_RS04450 (MF628_000890) - 986529..986699 (-) 171 WP_250272418.1 hypothetical protein -
  MF628_RS04455 (MF628_000891) - 986821..987363 (-) 543 WP_250272419.1 phage holin, LLH family -
  MF628_RS04460 (MF628_000892) - 987378..988298 (-) 921 WP_250272420.1 N-acetylmuramoyl-L-alanine amidase family protein -
  MF628_RS04465 (MF628_000893) - 988302..988703 (-) 402 WP_153794689.1 hypothetical protein -
  MF628_RS04470 (MF628_000894) - 988790..989719 (-) 930 WP_250273864.1 acetylxylan esterase -
  MF628_RS04475 (MF628_000895) - 989788..990933 (-) 1146 WP_250272421.1 hypothetical protein -
  MF628_RS04480 (MF628_000896) - 991012..993012 (-) 2001 WP_250272422.1 hypothetical protein -
  MF628_RS04485 (MF628_000897) - 993002..993553 (-) 552 WP_323873300.1 YmfQ family protein -
  MF628_RS04490 (MF628_000898) - 993546..994619 (-) 1074 WP_323873301.1 baseplate J/gp47 family protein -
  MF628_RS04495 (MF628_000899) - 994606..995013 (-) 408 WP_250272424.1 DUF2634 domain-containing protein -
  MF628_RS04500 (MF628_000900) - 995010..995369 (-) 360 WP_250272425.1 DUF2577 domain-containing protein -
  MF628_RS04505 (MF628_000901) - 995369..996367 (-) 999 WP_250272426.1 hypothetical protein -
  MF628_RS04510 (MF628_000902) - 996372..997082 (-) 711 WP_250272427.1 LysM peptidoglycan-binding domain-containing protein -
  MF628_RS04515 (MF628_000903) - 997100..999451 (-) 2352 WP_250272428.1 hypothetical protein -
  MF628_RS04520 (MF628_000904) - 999490..1000140 (-) 651 WP_076292398.1 hypothetical protein -
  MF628_RS04525 (MF628_000905) - 1000373..1000795 (-) 423 WP_250272429.1 phage tail assembly chaperone -
  MF628_RS04530 (MF628_000906) - 1000824..1001297 (-) 474 WP_250272430.1 phage tail tube protein -
  MF628_RS04535 (MF628_000907) - 1001299..1002621 (-) 1323 WP_323873302.1 phage tail sheath family protein -
  MF628_RS04540 (MF628_000908) - 1002621..1002863 (-) 243 WP_250272431.1 hypothetical protein -
  MF628_RS04545 (MF628_000909) - 1002856..1003281 (-) 426 WP_250272432.1 phage tail terminator family protein -
  MF628_RS04550 (MF628_000910) - 1003286..1003684 (-) 399 WP_064795251.1 HK97 gp10 family phage protein -
  MF628_RS04555 (MF628_000911) - 1003681..1004052 (-) 372 WP_250272433.1 ABC transporter ATP-binding protein -
  MF628_RS04560 (MF628_000912) - 1004055..1004429 (-) 375 WP_250272434.1 hypothetical protein -
  MF628_RS04565 (MF628_000913) - 1004443..1004637 (-) 195 WP_250272435.1 hypothetical protein -
  MF628_RS04570 (MF628_000914) - 1004655..1005647 (-) 993 WP_250272436.1 major capsid protein -
  MF628_RS04575 (MF628_000915) - 1005677..1006033 (-) 357 WP_250272437.1 hypothetical protein -
  MF628_RS04580 (MF628_000916) - 1006033..1006638 (-) 606 WP_250272438.1 phage scaffolding protein -
  MF628_RS04585 (MF628_000917) - 1006871..1008565 (-) 1695 WP_250272439.1 minor capsid protein -
  MF628_RS04590 (MF628_000918) - 1008562..1010031 (-) 1470 WP_250272440.1 phage portal protein -
  MF628_RS04595 (MF628_000919) - 1010047..1011288 (-) 1242 WP_250272441.1 PBSX family phage terminase large subunit -
  MF628_RS04600 (MF628_000920) terS 1011281..1012063 (-) 783 WP_250272442.1 phage terminase small subunit -
  MF628_RS04605 (MF628_000921) - 1012110..1012346 (-) 237 WP_250272443.1 hypothetical protein -
  MF628_RS04610 (MF628_000922) - 1012454..1013083 (-) 630 WP_250272444.1 DUF4367 domain-containing protein -
  MF628_RS04615 (MF628_000923) - 1013102..1013569 (-) 468 WP_250272445.1 peptidoglycan-binding domain-containing protein -
  MF628_RS04620 (MF628_000924) - 1013930..1014178 (-) 249 WP_250272446.1 hypothetical protein -
  MF628_RS04625 (MF628_000925) - 1015116..1015637 (-) 522 WP_250272447.1 sigma factor-like helix-turn-helix DNA-binding protein -
  MF628_RS04630 (MF628_000926) - 1015649..1015861 (-) 213 WP_103046804.1 hypothetical protein -
  MF628_RS04635 (MF628_06070) - 1015851..1015985 (-) 135 WP_323873303.1 hypothetical protein -
  MF628_RS04640 (MF628_000927) - 1016071..1016265 (-) 195 WP_250272448.1 hypothetical protein -
  MF628_RS04645 (MF628_000928) - 1016262..1016513 (-) 252 WP_250272449.1 hypothetical protein -
  MF628_RS04650 (MF628_000929) - 1016569..1017045 (-) 477 WP_250272450.1 hypothetical protein -
  MF628_RS04655 (MF628_000930) - 1017042..1017287 (-) 246 WP_250272451.1 hypothetical protein -
  MF628_RS04660 (MF628_000931) - 1017284..1017601 (-) 318 WP_250272452.1 hypothetical protein -
  MF628_RS04665 (MF628_000932) - 1017604..1017894 (-) 291 WP_250272453.1 hypothetical protein -
  MF628_RS04670 (MF628_000933) - 1017945..1018160 (-) 216 WP_250272454.1 hypothetical protein -
  MF628_RS04675 (MF628_000934) - 1018194..1018403 (-) 210 WP_061829343.1 hypothetical protein -
  MF628_RS04680 (MF628_000935) - 1018448..1018774 (-) 327 WP_250272455.1 hypothetical protein -
  MF628_RS04685 (MF628_000936) - 1018860..1019183 (-) 324 WP_250272456.1 hypothetical protein -
  MF628_RS04690 (MF628_000937) - 1019210..1019494 (-) 285 WP_250272457.1 hypothetical protein -
  MF628_RS04695 (MF628_000938) - 1019497..1019700 (-) 204 WP_250272458.1 hypothetical protein -
  MF628_RS04700 (MF628_000939) - 1019704..1020267 (-) 564 WP_250272459.1 dUTP diphosphatase -
  MF628_RS04705 (MF628_000940) - 1020338..1020868 (-) 531 WP_250272460.1 crossover junction endodeoxyribonuclease RuvC -
  MF628_RS04710 (MF628_000941) - 1020879..1021103 (-) 225 WP_250272461.1 hypothetical protein -
  MF628_RS04715 (MF628_000942) - 1021087..1021248 (-) 162 WP_250272462.1 hypothetical protein -
  MF628_RS04720 (MF628_000943) - 1021351..1021764 (-) 414 WP_250272463.1 YopX family protein -
  MF628_RS04725 (MF628_000944) - 1021802..1021960 (-) 159 WP_250268570.1 hypothetical protein -
  MF628_RS04730 (MF628_000945) - 1021957..1022295 (-) 339 WP_250272464.1 BC1872 family protein -
  MF628_RS04735 (MF628_000946) - 1022361..1023131 (-) 771 WP_323873342.1 ATP-binding protein -
  MF628_RS04740 (MF628_000947) - 1023145..1024050 (-) 906 WP_250272466.1 hypothetical protein -
  MF628_RS04745 (MF628_000948) - 1024059..1024592 (-) 534 WP_250272467.1 hypothetical protein -
  MF628_RS04750 (MF628_000949) - 1024573..1024929 (-) 357 WP_250272468.1 hypothetical protein -
  MF628_RS04755 (MF628_000950) - 1024934..1025266 (-) 333 WP_250272469.1 hypothetical protein -
  MF628_RS04760 (MF628_000951) ssbA 1025276..1025710 (-) 435 WP_250272470.1 single-stranded DNA-binding protein Machinery gene
  MF628_RS04765 (MF628_000952) - 1025703..1026338 (-) 636 WP_250272471.1 ERF family protein -
  MF628_RS04770 (MF628_000953) - 1026341..1026907 (-) 567 WP_250272472.1 host-nuclease inhibitor Gam family protein -
  MF628_RS04775 (MF628_000954) - 1026953..1027279 (-) 327 WP_250272473.1 hypothetical protein -
  MF628_RS04780 (MF628_000955) - 1027361..1027555 (-) 195 WP_250272474.1 hypothetical protein -
  MF628_RS04785 (MF628_000956) - 1027552..1027722 (-) 171 WP_250272475.1 hypothetical protein -
  MF628_RS04790 (MF628_000957) - 1027749..1028459 (-) 711 WP_250272476.1 Rha family transcriptional regulator -
  MF628_RS04795 (MF628_000958) - 1028503..1028649 (-) 147 WP_250272477.1 hypothetical protein -
  MF628_RS04800 (MF628_000959) - 1028718..1028927 (-) 210 WP_250272478.1 helix-turn-helix transcriptional regulator -
  MF628_RS04805 (MF628_08040) - 1029086..1029739 (+) 654 WP_250272479.1 LexA family protein -
  MF628_RS04810 (MF628_000961) - 1029752..1031176 (+) 1425 WP_250272480.1 recombinase family protein -
  MF628_RS04815 (MF628_000962) - 1031183..1032460 (+) 1278 Protein_952 SpoVR family protein -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16513.47 Da        Isoelectric Point: 5.7228

>NTDB_id=692096 MF628_RS04760 WP_250272470.1 1025276..1025710(-) (ssbA) [Paenibacillus polymyxa strain R 5.31]
MLNRVILIGRLTKDPELRYTPSGVAVTQFTLAVDRPFTSQGGEREADFLPIVTWRQLAETCANYLKKGRLTAVEGRVQVR
NYENSEGKRVYVTEIVADNVRFLEGNKDNSQRDPNEPDHRRHYDKDPFHDDGKPIDPADLDLPF

Nucleotide


Download         Length: 435 bp        

>NTDB_id=692096 MF628_RS04760 WP_250272470.1 1025276..1025710(-) (ssbA) [Paenibacillus polymyxa strain R 5.31]
ATGCTTAACCGTGTAATTTTGATCGGTCGTTTGACCAAAGATCCAGAGCTGCGCTATACACCGTCTGGTGTAGCAGTAAC
CCAGTTCACCCTAGCTGTAGACCGTCCGTTTACGAGTCAAGGCGGCGAACGGGAAGCGGATTTCTTGCCGATCGTAACCT
GGCGGCAGCTCGCTGAGACGTGTGCCAACTATCTTAAAAAGGGTCGTCTAACCGCTGTAGAGGGCCGTGTACAGGTGCGT
AACTACGAGAACAGCGAAGGCAAGCGGGTGTATGTAACTGAGATTGTAGCGGATAACGTGCGGTTTCTGGAGGGGAACAA
GGACAATAGTCAGCGAGACCCGAACGAACCGGACCATCGTCGTCATTATGATAAAGACCCGTTTCATGATGATGGAAAGC
CGATTGATCCAGCGGATTTAGATCTACCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

52.907

100

0.632
  ssb Latilactobacillus sakei subsp. sakei 23K

44.706

100

0.528
  ssbB Bacillus subtilis subsp. subtilis str. 168

55.769

72.222

0.403
  ssbB Streptococcus sobrinus strain NIDR 6715-7

46.957

79.861

0.375