Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M8851_RS07545 | Genome accession | NZ_CP097612 |
| Coordinates | 1580609..1581109 (+) | Length | 166 a.a. |
| NCBI ID | WP_005725039.1 | Uniprot ID | A0A379BD60 |
| Organism | Pasteurella multocida strain 33011 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1580609..1627480 | 1580609..1581109 | within | 0 |
Gene organization within MGE regions
Location: 1580609..1627480
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8851_RS07545 (M8851_07545) | ssb | 1580609..1581109 (+) | 501 | WP_005725039.1 | single-stranded DNA-binding protein | Machinery gene |
| M8851_RS07550 (M8851_07550) | folD | 1581615..1582469 (-) | 855 | WP_005752391.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| M8851_RS07565 (M8851_07565) | - | 1583226..1583570 (-) | 345 | WP_005755647.1 | Mor transcription activator family protein | - |
| M8851_RS07570 (M8851_07570) | - | 1583570..1584034 (-) | 465 | WP_032851747.1 | regulatory protein GemA | - |
| M8851_RS07575 (M8851_07575) | - | 1584110..1584670 (-) | 561 | WP_005755643.1 | YfbR-like 5'-deoxynucleotidase | - |
| M8851_RS07580 (M8851_07580) | - | 1584667..1584966 (-) | 300 | WP_005755641.1 | hypothetical protein | - |
| M8851_RS07585 (M8851_07585) | - | 1584968..1585528 (-) | 561 | WP_005755639.1 | DUF5420 family protein | - |
| M8851_RS07590 (M8851_07590) | - | 1585575..1585802 (-) | 228 | WP_005755637.1 | hypothetical protein | - |
| M8851_RS07595 (M8851_07595) | - | 1585803..1585970 (-) | 168 | WP_005755636.1 | hypothetical protein | - |
| M8851_RS07600 (M8851_07600) | - | 1585972..1586592 (-) | 621 | WP_005755634.1 | DUF3164 family protein | - |
| M8851_RS07605 (M8851_07605) | - | 1586612..1586866 (-) | 255 | WP_032851712.1 | hypothetical protein | - |
| M8851_RS07610 (M8851_07610) | - | 1586841..1587062 (-) | 222 | WP_005755632.1 | hypothetical protein | - |
| M8851_RS07615 (M8851_07615) | - | 1587072..1587395 (-) | 324 | WP_005755630.1 | hypothetical protein | - |
| M8851_RS07620 (M8851_07620) | - | 1587398..1588576 (-) | 1179 | WP_250190559.1 | AAA family ATPase | - |
| M8851_RS07625 (M8851_07625) | - | 1588588..1590357 (-) | 1770 | WP_005755626.1 | DDE-type integrase/transposase/recombinase | - |
| M8851_RS07630 (M8851_07630) | - | 1590369..1591313 (-) | 945 | WP_005755624.1 | hypothetical protein | - |
| M8851_RS07635 (M8851_07635) | - | 1591324..1591638 (-) | 315 | WP_005755623.1 | hypothetical protein | - |
| M8851_RS07640 (M8851_07640) | - | 1591651..1591836 (-) | 186 | WP_005755622.1 | hypothetical protein | - |
| M8851_RS07645 (M8851_07645) | - | 1591916..1592152 (-) | 237 | WP_005755620.1 | DNA-binding protein | - |
| M8851_RS07650 (M8851_07650) | - | 1592217..1592444 (+) | 228 | WP_025248436.1 | hypothetical protein | - |
| M8851_RS07655 (M8851_07655) | - | 1592621..1593031 (+) | 411 | WP_005755617.1 | helix-turn-helix transcriptional regulator | - |
| M8851_RS07660 (M8851_07660) | - | 1593062..1593589 (+) | 528 | WP_032851711.1 | hypothetical protein | - |
| M8851_RS07665 (M8851_07665) | - | 1593602..1594192 (+) | 591 | WP_005755613.1 | hypothetical protein | - |
| M8851_RS07670 (M8851_07670) | - | 1594250..1594495 (+) | 246 | WP_005755610.1 | hypothetical protein | - |
| M8851_RS07675 (M8851_07675) | - | 1594634..1595602 (+) | 969 | WP_005755607.1 | nucleoid-associated protein | - |
| M8851_RS07680 (M8851_07680) | - | 1595602..1596780 (+) | 1179 | WP_005755605.1 | hypothetical protein | - |
| M8851_RS07685 (M8851_07685) | - | 1597000..1597371 (+) | 372 | WP_005755602.1 | putative holin | - |
| M8851_RS07690 (M8851_07690) | - | 1597373..1597969 (+) | 597 | WP_005755599.1 | transglycosylase SLT domain-containing protein | - |
| M8851_RS07695 (M8851_07695) | - | 1597960..1598403 (+) | 444 | WP_192940804.1 | hypothetical protein | - |
| M8851_RS07700 (M8851_07700) | - | 1598500..1598850 (+) | 351 | WP_005755594.1 | hypothetical protein | - |
| M8851_RS07705 (M8851_07705) | - | 1598852..1599157 (+) | 306 | WP_005755593.1 | hypothetical protein | - |
| M8851_RS07710 (M8851_07710) | - | 1599169..1599711 (+) | 543 | WP_005755592.1 | DUF3486 family protein | - |
| M8851_RS07715 (M8851_07715) | - | 1599711..1601279 (+) | 1569 | WP_005755591.1 | terminase family protein | - |
| M8851_RS07720 (M8851_07720) | - | 1601282..1602805 (+) | 1524 | WP_005755590.1 | DUF935 family protein | - |
| M8851_RS07725 (M8851_07725) | - | 1602789..1604027 (+) | 1239 | WP_005755589.1 | PBECR2 nuclease fold domain-containing protein | - |
| M8851_RS07730 (M8851_07730) | - | 1604125..1604625 (+) | 501 | WP_005755588.1 | phage virion morphogenesis protein | - |
| M8851_RS07735 (M8851_07735) | - | 1604843..1605844 (+) | 1002 | WP_250190560.1 | peptidase | - |
| M8851_RS07740 (M8851_07740) | - | 1605841..1606206 (+) | 366 | WP_005755586.1 | capsid cement protein | - |
| M8851_RS07745 (M8851_07745) | - | 1606268..1607191 (+) | 924 | WP_005755585.1 | hypothetical protein | - |
| M8851_RS07750 (M8851_07750) | - | 1607201..1607707 (+) | 507 | WP_005755584.1 | DUF1320 domain-containing protein | - |
| M8851_RS07755 (M8851_07755) | - | 1607707..1608153 (+) | 447 | WP_005755583.1 | hypothetical protein | - |
| M8851_RS07760 (M8851_07760) | - | 1608150..1608410 (+) | 261 | WP_005755582.1 | hypothetical protein | - |
| M8851_RS07765 (M8851_07765) | - | 1608403..1609149 (+) | 747 | WP_005755580.1 | hypothetical protein | - |
| M8851_RS07770 (M8851_07770) | - | 1609210..1609635 (+) | 426 | WP_005755578.1 | DUF6631 family protein | - |
| M8851_RS07775 (M8851_07775) | - | 1609846..1610061 (-) | 216 | WP_005755576.1 | hypothetical protein | - |
| M8851_RS07780 (M8851_07780) | - | 1610074..1613412 (+) | 3339 | WP_005755574.1 | tape measure protein | - |
| M8851_RS07785 (M8851_07785) | - | 1613423..1614415 (+) | 993 | WP_005755572.1 | hypothetical protein | - |
| M8851_RS07790 (M8851_07790) | - | 1614417..1615379 (+) | 963 | WP_005755570.1 | hypothetical protein | - |
| M8851_RS07795 (M8851_07795) | - | 1615387..1617066 (+) | 1680 | WP_005755569.1 | hypothetical protein | - |
| M8851_RS07800 (M8851_07800) | - | 1617091..1617900 (+) | 810 | WP_005755567.1 | phage BR0599 family protein | - |
| M8851_RS07805 (M8851_07805) | - | 1617917..1618168 (+) | 252 | WP_005755565.1 | hypothetical protein | - |
| M8851_RS07810 (M8851_07810) | - | 1618172..1618372 (+) | 201 | WP_005755563.1 | hypothetical protein | - |
| M8851_RS07815 (M8851_07815) | - | 1618372..1621173 (+) | 2802 | WP_250028294.1 | phage tail protein | - |
| M8851_RS07820 (M8851_07820) | - | 1621239..1621499 (+) | 261 | WP_005755559.1 | Gp49 family protein | - |
| M8851_RS07825 (M8851_07825) | - | 1621651..1622496 (+) | 846 | WP_005755558.1 | hypothetical protein | - |
| M8851_RS07830 (M8851_07830) | - | 1622799..1623218 (+) | 420 | WP_005719426.1 | DUF417 family protein | - |
| M8851_RS07835 (M8851_07835) | lipA | 1623296..1624258 (-) | 963 | WP_005755556.1 | lipoyl synthase | - |
| M8851_RS07840 (M8851_07840) | lipB | 1624323..1624979 (-) | 657 | WP_005755554.1 | lipoyl(octanoyl) transferase LipB | - |
| M8851_RS07845 (M8851_07845) | ybeD | 1624986..1625282 (-) | 297 | WP_005719420.1 | DUF493 family protein YbeD | - |
| M8851_RS07850 (M8851_07850) | - | 1625385..1626569 (-) | 1185 | WP_005752389.1 | serine hydrolase | - |
| M8851_RS07855 (M8851_07855) | - | 1626596..1627480 (-) | 885 | WP_005755551.1 | septal ring lytic transglycosylase RlpA family protein | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18657.68 Da Isoelectric Point: 5.3353
>NTDB_id=691221 M8851_RS07545 WP_005725039.1 1580609..1581109(+) (ssb) [Pasteurella multocida strain 33011]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=691221 M8851_RS07545 WP_005725039.1 1580609..1581109(+) (ssb) [Pasteurella multocida strain 33011]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTCTAA
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
69.231 |
100 |
0.759 |
| ssb | Vibrio cholerae strain A1552 |
53.591 |
100 |
0.584 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.47 |