Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   M8851_RS03180 Genome accession   NZ_CP097612
Coordinates   670702..671154 (-) Length   150 a.a.
NCBI ID   WP_250190659.1    Uniprot ID   -
Organism   Pasteurella multocida strain 33011     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 664253..709460 670702..671154 within 0


Gene organization within MGE regions


Location: 664253..709460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8851_RS03115 (M8851_03115) - 664253..665284 (-) 1032 WP_250190649.1 tyrosine-type recombinase/integrase -
  M8851_RS03120 (M8851_03120) - 665286..665537 (-) 252 WP_042742798.1 DUF4224 domain-containing protein -
  M8851_RS03125 (M8851_03125) - 665574..665873 (-) 300 WP_250190650.1 hypothetical protein -
  M8851_RS03130 (M8851_03130) - 665877..666170 (-) 294 WP_250190651.1 hypothetical protein -
  M8851_RS03135 (M8851_03135) - 666174..666380 (-) 207 WP_250190652.1 hypothetical protein -
  M8851_RS03140 (M8851_03140) - 666492..667583 (-) 1092 WP_250190653.1 RelA/SpoT domain-containing protein -
  M8851_RS03145 (M8851_03145) rdgC 667931..668833 (-) 903 WP_250190654.1 recombination-associated protein RdgC -
  M8851_RS03150 (M8851_03150) - 668836..669219 (-) 384 WP_078836134.1 hypothetical protein -
  M8851_RS03155 (M8851_03155) - 669230..669529 (-) 300 WP_250190655.1 hypothetical protein -
  M8851_RS03160 (M8851_03160) - 669608..669952 (-) 345 WP_250190656.1 hypothetical protein -
  M8851_RS03165 (M8851_03165) - 669973..670236 (-) 264 WP_250190657.1 hypothetical protein -
  M8851_RS03170 (M8851_03170) - 670267..670476 (-) 210 WP_250190658.1 hypothetical protein -
  M8851_RS03175 (M8851_03175) - 670478..670660 (-) 183 WP_211634800.1 hypothetical protein -
  M8851_RS03180 (M8851_03180) ssb 670702..671154 (-) 453 WP_250190659.1 single-stranded DNA-binding protein Machinery gene
  M8851_RS03185 (M8851_03185) - 671158..671769 (-) 612 WP_211634799.1 YqaJ viral recombinase family protein -
  M8851_RS03190 (M8851_03190) bet 671766..672548 (-) 783 WP_211634798.1 phage recombination protein Bet -
  M8851_RS03195 (M8851_03195) - 672558..673490 (-) 933 WP_211634797.1 hypothetical protein -
  M8851_RS03200 (M8851_03200) - 673493..673654 (-) 162 WP_165523898.1 hypothetical protein -
  M8851_RS03205 (M8851_03205) - 673664..673903 (-) 240 WP_108574998.1 hypothetical protein -
  M8851_RS03215 (M8851_03215) - 674328..674555 (-) 228 WP_250190660.1 hypothetical protein -
  M8851_RS03220 (M8851_03220) - 675080..677014 (+) 1935 WP_079157962.1 ATP-binding protein -
  M8851_RS03225 (M8851_03225) - 677166..677711 (-) 546 WP_115098348.1 hypothetical protein -
  M8851_RS03230 (M8851_03230) - 677748..678710 (-) 963 WP_115098347.1 hypothetical protein -
  M8851_RS03235 (M8851_03235) - 678783..679472 (-) 690 WP_250190662.1 helix-turn-helix transcriptional regulator -
  M8851_RS03240 (M8851_03240) - 679600..679809 (+) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  M8851_RS03245 (M8851_03245) - 679882..680310 (+) 429 WP_250192350.1 phage regulatory CII family protein -
  M8851_RS03250 (M8851_03250) - 680375..680512 (+) 138 WP_165544545.1 hypothetical protein -
  M8851_RS03255 (M8851_03255) - 680556..680786 (+) 231 WP_250190664.1 helix-turn-helix domain-containing protein -
  M8851_RS03260 (M8851_03260) - 680788..680925 (+) 138 WP_250190665.1 hypothetical protein -
  M8851_RS03265 (M8851_03265) - 680906..681772 (+) 867 WP_250192351.1 hypothetical protein -
  M8851_RS03270 (M8851_03270) - 681772..683208 (+) 1437 WP_223131912.1 DnaB-like helicase C-terminal domain-containing protein -
  M8851_RS03275 (M8851_03275) - 683212..683637 (+) 426 WP_250190667.1 recombination protein NinB -
  M8851_RS03280 (M8851_03280) - 683711..684292 (+) 582 WP_250190668.1 recombination protein NinG -
  M8851_RS03285 (M8851_03285) - 684289..684792 (+) 504 WP_250011907.1 antiterminator Q family protein -
  M8851_RS03295 (M8851_03295) - 685045..685305 (+) 261 WP_014391475.1 holin -
  M8851_RS03300 (M8851_03300) - 685302..685832 (+) 531 WP_005725607.1 lysozyme -
  M8851_RS03305 (M8851_03305) - 685805..686128 (+) 324 WP_078819738.1 DUF2570 family protein -
  M8851_RS03310 (M8851_03310) - 686034..686315 (+) 282 WP_078819735.1 hypothetical protein -
  M8851_RS03315 (M8851_03315) - 686348..686782 (-) 435 WP_096742995.1 type II toxin-antitoxin system HicB family antitoxin -
  M8851_RS03320 (M8851_03320) - 686811..686993 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  M8851_RS03325 (M8851_03325) - 687332..687808 (+) 477 WP_061406081.1 DUF1441 family protein -
  M8851_RS03330 (M8851_03330) - 687811..689919 (+) 2109 WP_250192352.1 phage terminase large subunit family protein -
  M8851_RS03335 (M8851_03335) - 689916..690137 (+) 222 WP_014391481.1 hypothetical protein -
  M8851_RS03340 (M8851_03340) - 690134..691669 (+) 1536 WP_250190621.1 phage portal protein -
  M8851_RS03345 (M8851_03345) - 691605..693614 (+) 2010 WP_250190622.1 ClpP-like prohead protease/major capsid protein fusion protein -
  M8851_RS03350 (M8851_03350) - 693684..694010 (+) 327 WP_016570083.1 capsid cement protein -
  M8851_RS03355 (M8851_03355) - 694003..694296 (+) 294 WP_014391484.1 hypothetical protein -
  M8851_RS03360 (M8851_03360) - 694296..694847 (+) 552 WP_250190623.1 phage tail protein -
  M8851_RS03365 (M8851_03365) gpU 694844..695251 (+) 408 WP_115098330.1 phage tail terminator protein -
  M8851_RS03370 (M8851_03370) - 695248..695757 (+) 510 WP_046339069.1 phage tail tube protein -
  M8851_RS03375 (M8851_03375) - 695760..696149 (+) 390 WP_250190624.1 phage minor tail protein G -
  M8851_RS03380 (M8851_03380) - 696170..696472 (+) 303 WP_258553973.1 phage tail assembly protein T -
  M8851_RS03385 (M8851_03385) - 696459..698855 (+) 2397 WP_250190625.1 phage tail length tape measure family protein -
  M8851_RS03390 (M8851_03390) - 698855..699202 (+) 348 WP_115098326.1 phage tail protein -
  M8851_RS03395 (M8851_03395) - 699277..699831 (+) 555 WP_250190626.1 UDP-N-acetylglucosamine acyltransferase -
  M8851_RS03400 (M8851_03400) - 699880..700530 (+) 651 WP_250190627.1 phage minor tail protein L -
  M8851_RS03405 (M8851_03405) - 700532..701245 (+) 714 WP_250190628.1 C40 family peptidase -
  M8851_RS03410 (M8851_03410) - 701178..701897 (+) 720 WP_250012425.1 tail assembly protein -
  M8851_RS03415 (M8851_03415) - 701901..705548 (+) 3648 WP_250192353.1 phage tail protein -
  M8851_RS03420 (M8851_03420) - 705562..707265 (+) 1704 WP_250190631.1 pyocin knob domain-containing protein -
  M8851_RS03425 (M8851_03425) - 707276..707878 (+) 603 WP_250192354.1 hypothetical protein -
  M8851_RS03430 (M8851_03430) - 707875..708336 (+) 462 WP_115098319.1 enoyl-CoA hydratase -
  M8851_RS03435 (M8851_03435) - 708618..709460 (-) 843 WP_005754053.1 patatin family protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 16994.75 Da        Isoelectric Point: 7.9749

>NTDB_id=691213 M8851_RS03180 WP_250190659.1 670702..671154(-) (ssb) [Pasteurella multocida strain 33011]
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQTPQNNAYANAKNGKPAQQQSDNFKDDDTPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=691213 M8851_RS03180 WP_250190659.1 670702..671154(-) (ssb) [Pasteurella multocida strain 33011]
ATGGCAGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCTACGAGCGAAAGTTGGATCGACAAAAACACCAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTGTATGTAGAAGGT
CGTTTAAAAACTCGCAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGACTCACAGCCACAGCAAGCACAGACACCACAAAACAATGCTTATGCGAATGCGAAAAATGGAA
AGCCAGCACAGCAACAGTCAGATAATTTTAAAGACGACGACACCCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

64.088

100

0.773
  ssb Vibrio cholerae strain A1552

53.957

92.667

0.5
  ssb Neisseria gonorrhoeae MS11

46.715

91.333

0.427
  ssb Neisseria meningitidis MC58

46.715

91.333

0.427