Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M8851_RS02210 | Genome accession | NZ_CP097612 |
| Coordinates | 467818..468246 (-) | Length | 142 a.a. |
| NCBI ID | WP_250190612.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 33011 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 445193..504098 | 467818..468246 | within | 0 |
Gene organization within MGE regions
Location: 445193..504098
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8851_RS02105 (M8851_02105) | - | 445193..446626 (-) | 1434 | WP_005754206.1 | glycosyltransferase family 2 protein | - |
| M8851_RS02110 (M8851_02110) | - | 446619..447791 (-) | 1173 | WP_005754204.1 | nucleotide sugar dehydrogenase | - |
| M8851_RS02115 (M8851_02115) | - | 447855..450773 (-) | 2919 | WP_005754202.1 | glycosyltransferase | - |
| M8851_RS02120 (M8851_02120) | - | 450790..452658 (-) | 1869 | WP_005754200.1 | hypothetical protein | - |
| M8851_RS02125 (M8851_02125) | - | 453040..455097 (+) | 2058 | WP_348524436.1 | capsular polysaccharide biosynthesis protein | - |
| M8851_RS02130 (M8851_02130) | - | 455107..456333 (+) | 1227 | WP_005754196.1 | capsule biosynthesis protein | - |
| M8851_RS02135 (M8851_02135) | - | 456369..456821 (+) | 453 | WP_005716569.1 | DUF441 domain-containing protein | - |
| M8851_RS02140 (M8851_02140) | - | 456843..457226 (+) | 384 | WP_005754194.1 | DUF423 domain-containing protein | - |
| M8851_RS02145 (M8851_02145) | hrpA | 457226..461137 (+) | 3912 | WP_250190706.1 | ATP-dependent RNA helicase HrpA | - |
| M8851_RS02155 (M8851_02155) | - | 461841..463130 (+) | 1290 | WP_169326192.1 | integrase arm-type DNA-binding domain-containing protein | - |
| M8851_RS02160 (M8851_02160) | - | 463111..463287 (-) | 177 | WP_169326193.1 | helix-turn-helix domain-containing protein | - |
| M8851_RS02165 (M8851_02165) | - | 463502..463690 (-) | 189 | WP_238300505.1 | hypothetical protein | - |
| M8851_RS02170 (M8851_02170) | - | 463693..464136 (-) | 444 | WP_250190606.1 | pyruvate kinase | - |
| M8851_RS02175 (M8851_02175) | - | 464192..464776 (-) | 585 | WP_250190607.1 | DUF551 domain-containing protein | - |
| M8851_RS02180 (M8851_02180) | - | 464779..465264 (-) | 486 | WP_078737840.1 | methyltransferase | - |
| M8851_RS02185 (M8851_02185) | - | 465313..465528 (-) | 216 | WP_250190608.1 | hypothetical protein | - |
| M8851_RS02190 (M8851_02190) | - | 465620..465892 (-) | 273 | WP_250190609.1 | hypothetical protein | - |
| M8851_RS02195 (M8851_02195) | - | 465889..466488 (-) | 600 | WP_250190610.1 | hypothetical protein | - |
| M8851_RS02200 (M8851_02200) | - | 466543..467331 (-) | 789 | WP_250190611.1 | DUF2303 family protein | - |
| M8851_RS02205 (M8851_02205) | - | 467403..467756 (-) | 354 | WP_016570064.1 | hypothetical protein | - |
| M8851_RS02210 (M8851_02210) | ssb | 467818..468246 (-) | 429 | WP_250190612.1 | single-stranded DNA-binding protein | Machinery gene |
| M8851_RS02215 (M8851_02215) | - | 468247..468522 (-) | 276 | WP_250190613.1 | hypothetical protein | - |
| M8851_RS02220 (M8851_02220) | - | 469125..469667 (+) | 543 | WP_250190614.1 | hypothetical protein | - |
| M8851_RS02225 (M8851_02225) | - | 469799..469975 (-) | 177 | WP_169326206.1 | hypothetical protein | - |
| M8851_RS02230 (M8851_02230) | - | 470297..471247 (-) | 951 | WP_071171098.1 | hypothetical protein | - |
| M8851_RS02235 (M8851_02235) | - | 471353..472009 (-) | 657 | WP_223131937.1 | XRE family transcriptional regulator | - |
| M8851_RS02240 (M8851_02240) | - | 472139..472345 (+) | 207 | WP_223131938.1 | helix-turn-helix transcriptional regulator | - |
| M8851_RS02245 (M8851_02245) | - | 472394..472843 (+) | 450 | WP_250190615.1 | YmfL family putative regulatory protein | - |
| M8851_RS02250 (M8851_02250) | - | 472901..473653 (+) | 753 | WP_238300483.1 | Rha family transcriptional regulator | - |
| M8851_RS02255 (M8851_02255) | - | 473650..474720 (+) | 1071 | WP_250190616.1 | conserved phage C-terminal domain-containing protein | - |
| M8851_RS02260 (M8851_02260) | - | 474729..475262 (+) | 534 | WP_238300556.1 | phage N-6-adenine-methyltransferase | - |
| M8851_RS02265 (M8851_02265) | - | 475271..476248 (+) | 978 | WP_250190617.1 | DUF968 domain-containing protein | - |
| M8851_RS02270 (M8851_02270) | - | 476248..476622 (+) | 375 | WP_250190618.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M8851_RS02275 (M8851_02275) | - | 476609..476995 (+) | 387 | WP_167829995.1 | antiterminator Q family protein | - |
| M8851_RS02280 (M8851_02280) | - | 477148..477513 (+) | 366 | WP_238300477.1 | phage holin, lambda family | - |
| M8851_RS02285 (M8851_02285) | - | 477485..478069 (+) | 585 | WP_238300475.1 | glycoside hydrolase family 19 protein | - |
| M8851_RS02290 (M8851_02290) | - | 478072..478395 (+) | 324 | WP_238300473.1 | DUF2570 family protein | - |
| M8851_RS02295 (M8851_02295) | - | 478607..478975 (-) | 369 | WP_014391478.1 | helix-turn-helix transcriptional regulator | - |
| M8851_RS02300 (M8851_02300) | - | 479012..479272 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M8851_RS02305 (M8851_02305) | - | 479563..480027 (+) | 465 | WP_250190619.1 | DUF1441 family protein | - |
| M8851_RS02310 (M8851_02310) | - | 480042..482150 (+) | 2109 | WP_250190620.1 | phage terminase large subunit family protein | - |
| M8851_RS02315 (M8851_02315) | - | 482147..482368 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| M8851_RS02320 (M8851_02320) | - | 482365..483900 (+) | 1536 | WP_250190621.1 | phage portal protein | - |
| M8851_RS02325 (M8851_02325) | - | 483836..485845 (+) | 2010 | WP_250190622.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| M8851_RS02330 (M8851_02330) | - | 485915..486241 (+) | 327 | WP_016570083.1 | capsid cement protein | - |
| M8851_RS02335 (M8851_02335) | - | 486234..486527 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| M8851_RS02340 (M8851_02340) | - | 486527..487078 (+) | 552 | WP_250190623.1 | phage tail protein | - |
| M8851_RS02345 (M8851_02345) | gpU | 487075..487482 (+) | 408 | WP_115098330.1 | phage tail terminator protein | - |
| M8851_RS02350 (M8851_02350) | - | 487479..487988 (+) | 510 | WP_046339069.1 | phage tail tube protein | - |
| M8851_RS02355 (M8851_02355) | - | 487991..488380 (+) | 390 | WP_250190624.1 | phage minor tail protein G | - |
| M8851_RS02360 (M8851_02360) | - | 488401..488703 (+) | 303 | WP_258553973.1 | phage tail assembly protein T | - |
| M8851_RS02365 (M8851_02365) | - | 488690..491086 (+) | 2397 | WP_250190625.1 | phage tail length tape measure family protein | - |
| M8851_RS02370 (M8851_02370) | - | 491086..491433 (+) | 348 | WP_115098326.1 | phage tail protein | - |
| M8851_RS02375 (M8851_02375) | - | 491508..492062 (+) | 555 | WP_250190626.1 | UDP-N-acetylglucosamine acyltransferase | - |
| M8851_RS02380 (M8851_02380) | - | 492111..492761 (+) | 651 | WP_250190627.1 | phage minor tail protein L | - |
| M8851_RS02385 (M8851_02385) | - | 492763..493476 (+) | 714 | WP_250190628.1 | C40 family peptidase | - |
| M8851_RS02390 (M8851_02390) | - | 493409..494134 (+) | 726 | WP_250190629.1 | tail assembly protein | - |
| M8851_RS02395 (M8851_02395) | - | 494138..497785 (+) | 3648 | WP_250190630.1 | phage tail protein | - |
| M8851_RS02400 (M8851_02400) | - | 497799..499511 (+) | 1713 | WP_250192347.1 | tail fiber protein | - |
| M8851_RS02405 (M8851_02405) | - | 499522..500109 (+) | 588 | WP_250190632.1 | DUF4376 domain-containing protein | - |
| M8851_RS02410 (M8851_02410) | - | 500099..500356 (+) | 258 | WP_250190633.1 | DNA helicase UvrD | - |
| M8851_RS02415 (M8851_02415) | - | 500389..500748 (-) | 360 | WP_250190634.1 | hypothetical protein | - |
| M8851_RS02420 (M8851_02420) | - | 500801..501484 (-) | 684 | WP_250190635.1 | hypothetical protein | - |
| M8851_RS02425 (M8851_02425) | - | 501545..501742 (-) | 198 | WP_005725436.1 | ribbon-helix-helix protein, CopG family | - |
| M8851_RS02430 (M8851_02430) | - | 501739..502374 (-) | 636 | WP_250190636.1 | DNA methyltransferase | - |
| M8851_RS02435 (M8851_02435) | - | 502371..504098 (-) | 1728 | WP_250190637.1 | DEAD/DEAH box helicase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15922.85 Da Isoelectric Point: 6.7216
>NTDB_id=691212 M8851_RS02210 WP_250190612.1 467818..468246(-) (ssb) [Pasteurella multocida strain 33011]
MAGVNKVIIVGNLGQDPDHKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITLYRRQADIAAQFLKKGSKVYIEG
RLRTRKWQDQSGQERYITEILADKIVLLDSKQTAGTGNSNPPPEQQQHDPYGDAFNCDNIPF
MAGVNKVIIVGNLGQDPDHKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITLYRRQADIAAQFLKKGSKVYIEG
RLRTRKWQDQSGQERYITEILADKIVLLDSKQTAGTGNSNPPPEQQQHDPYGDAFNCDNIPF
Nucleotide
Download Length: 429 bp
>NTDB_id=691212 M8851_RS02210 WP_250190612.1 467818..468246(-) (ssb) [Pasteurella multocida strain 33011]
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGACAAGACCCAGATCACAAAGTAATGACAAATGGCGATCC
CGTGACCAATATCAGCGTGGCCACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAACGCGAAGTTGTCGAATGGC
ACCGTATTACGCTATATCGACGACAAGCAGACATTGCCGCGCAGTTTTTGAAAAAAGGCTCAAAAGTTTATATTGAAGGT
CGTTTGCGAACTCGAAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACGGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGACTGCAGGCACTGGCAATAGCAATCCACCACCGGAACAACAGCAACATGATCCGTATGGTGATG
CATTTAATTGTGACAATATTCCATTCTGA
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGACAAGACCCAGATCACAAAGTAATGACAAATGGCGATCC
CGTGACCAATATCAGCGTGGCCACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAACGCGAAGTTGTCGAATGGC
ACCGTATTACGCTATATCGACGACAAGCAGACATTGCCGCGCAGTTTTTGAAAAAAGGCTCAAAAGTTTATATTGAAGGT
CGTTTGCGAACTCGAAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACGGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGACTGCAGGCACTGGCAATAGCAATCCACCACCGGAACAACAGCAACATGATCCGTATGGTGATG
CATTTAATTGTGACAATATTCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
66.087 |
80.986 |
0.535 |
| ssb | Neisseria meningitidis MC58 |
43.662 |
100 |
0.437 |
| ssb | Vibrio cholerae strain A1552 |
62.626 |
69.718 |
0.437 |
| ssb | Neisseria gonorrhoeae MS11 |
47.368 |
80.282 |
0.38 |