Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M8850_RS07440 | Genome accession | NZ_CP097610 |
| Coordinates | 1565648..1566148 (+) | Length | 166 a.a. |
| NCBI ID | WP_005725039.1 | Uniprot ID | A0A379BD60 |
| Organism | Pasteurella multocida strain 32985 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1565648..1609297 | 1565648..1566148 | within | 0 |
Gene organization within MGE regions
Location: 1565648..1609297
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8850_RS07440 (M8850_07440) | ssb | 1565648..1566148 (+) | 501 | WP_005725039.1 | single-stranded DNA-binding protein | Machinery gene |
| M8850_RS07445 (M8850_07445) | folD | 1566654..1567508 (-) | 855 | WP_005752391.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| M8850_RS07460 (M8850_07460) | - | 1568265..1568609 (-) | 345 | WP_005755647.1 | Mor transcription activator family protein | - |
| M8850_RS07465 (M8850_07465) | - | 1568609..1569073 (-) | 465 | WP_032851747.1 | regulatory protein GemA | - |
| M8850_RS07470 (M8850_07470) | - | 1569149..1569709 (-) | 561 | WP_005755643.1 | YfbR-like 5'-deoxynucleotidase | - |
| M8850_RS07475 (M8850_07475) | - | 1569706..1570005 (-) | 300 | WP_005755641.1 | hypothetical protein | - |
| M8850_RS07480 (M8850_07480) | - | 1570007..1570567 (-) | 561 | WP_005755639.1 | DUF5420 family protein | - |
| M8850_RS07485 (M8850_07485) | - | 1570614..1570841 (-) | 228 | WP_005755637.1 | hypothetical protein | - |
| M8850_RS07490 (M8850_07490) | - | 1570842..1571009 (-) | 168 | WP_005755636.1 | hypothetical protein | - |
| M8850_RS07495 (M8850_07495) | - | 1571011..1571631 (-) | 621 | WP_005755634.1 | DUF3164 family protein | - |
| M8850_RS07500 (M8850_07500) | - | 1571651..1571905 (-) | 255 | WP_032851712.1 | hypothetical protein | - |
| M8850_RS07505 (M8850_07505) | - | 1571880..1572101 (-) | 222 | WP_005755632.1 | hypothetical protein | - |
| M8850_RS07510 (M8850_07510) | - | 1572111..1572434 (-) | 324 | WP_005755630.1 | hypothetical protein | - |
| M8850_RS07515 (M8850_07515) | - | 1572437..1573615 (-) | 1179 | WP_250190559.1 | AAA family ATPase | - |
| M8850_RS07520 (M8850_07520) | - | 1573627..1575396 (-) | 1770 | WP_005755626.1 | DDE-type integrase/transposase/recombinase | - |
| M8850_RS07525 (M8850_07525) | - | 1575408..1576352 (-) | 945 | WP_005755624.1 | hypothetical protein | - |
| M8850_RS07530 (M8850_07530) | - | 1576363..1576677 (-) | 315 | WP_005755623.1 | hypothetical protein | - |
| M8850_RS07535 (M8850_07535) | - | 1576690..1576875 (-) | 186 | WP_005755622.1 | hypothetical protein | - |
| M8850_RS07540 (M8850_07540) | - | 1576955..1577191 (-) | 237 | WP_005755620.1 | DNA-binding protein | - |
| M8850_RS07545 (M8850_07545) | - | 1577256..1577483 (+) | 228 | WP_025248436.1 | hypothetical protein | - |
| M8850_RS07550 (M8850_07550) | - | 1577660..1578070 (+) | 411 | WP_005755617.1 | helix-turn-helix transcriptional regulator | - |
| M8850_RS07555 (M8850_07555) | - | 1578101..1578628 (+) | 528 | WP_032851711.1 | hypothetical protein | - |
| M8850_RS07560 (M8850_07560) | - | 1578641..1579231 (+) | 591 | WP_005755613.1 | hypothetical protein | - |
| M8850_RS07565 (M8850_07565) | - | 1579289..1579534 (+) | 246 | WP_005755610.1 | hypothetical protein | - |
| M8850_RS07570 (M8850_07570) | - | 1579673..1580641 (+) | 969 | WP_005755607.1 | nucleoid-associated protein | - |
| M8850_RS07575 (M8850_07575) | - | 1580641..1581819 (+) | 1179 | WP_005755605.1 | hypothetical protein | - |
| M8850_RS07580 (M8850_07580) | - | 1582039..1582410 (+) | 372 | WP_005755602.1 | putative holin | - |
| M8850_RS07585 (M8850_07585) | - | 1582412..1583008 (+) | 597 | WP_005755599.1 | transglycosylase SLT domain-containing protein | - |
| M8850_RS07590 (M8850_07590) | - | 1582999..1583442 (+) | 444 | WP_192940804.1 | hypothetical protein | - |
| M8850_RS07595 (M8850_07595) | - | 1583539..1583889 (+) | 351 | WP_005755594.1 | hypothetical protein | - |
| M8850_RS07600 (M8850_07600) | - | 1583891..1584196 (+) | 306 | WP_005755593.1 | hypothetical protein | - |
| M8850_RS07605 (M8850_07605) | - | 1584208..1584750 (+) | 543 | WP_005755592.1 | DUF3486 family protein | - |
| M8850_RS07610 (M8850_07610) | - | 1584750..1586318 (+) | 1569 | WP_005755591.1 | terminase family protein | - |
| M8850_RS07615 (M8850_07615) | - | 1586321..1587844 (+) | 1524 | WP_005755590.1 | DUF935 family protein | - |
| M8850_RS07620 (M8850_07620) | - | 1587828..1589066 (+) | 1239 | WP_005755589.1 | PBECR2 nuclease fold domain-containing protein | - |
| M8850_RS07625 (M8850_07625) | - | 1589164..1589664 (+) | 501 | WP_005755588.1 | phage virion morphogenesis protein | - |
| M8850_RS07630 (M8850_07630) | - | 1589882..1590883 (+) | 1002 | WP_250190560.1 | peptidase | - |
| M8850_RS07635 (M8850_07635) | - | 1590880..1591245 (+) | 366 | WP_005755586.1 | capsid cement protein | - |
| M8850_RS07640 (M8850_07640) | - | 1591307..1592230 (+) | 924 | WP_005755585.1 | hypothetical protein | - |
| M8850_RS07645 (M8850_07645) | - | 1592240..1592746 (+) | 507 | WP_005755584.1 | DUF1320 domain-containing protein | - |
| M8850_RS07650 (M8850_07650) | - | 1592746..1593192 (+) | 447 | WP_005755583.1 | hypothetical protein | - |
| M8850_RS07655 (M8850_07655) | - | 1593189..1593449 (+) | 261 | WP_005755582.1 | hypothetical protein | - |
| M8850_RS07660 (M8850_07660) | - | 1593442..1594188 (+) | 747 | WP_005755580.1 | hypothetical protein | - |
| M8850_RS07665 (M8850_07665) | - | 1594249..1594674 (+) | 426 | WP_005755578.1 | DUF6631 family protein | - |
| M8850_RS07670 (M8850_07670) | - | 1594885..1595100 (-) | 216 | WP_005755576.1 | hypothetical protein | - |
| M8850_RS07675 (M8850_07675) | - | 1595113..1598451 (+) | 3339 | WP_005755574.1 | tape measure protein | - |
| M8850_RS07680 (M8850_07680) | - | 1598462..1599454 (+) | 993 | WP_005755572.1 | hypothetical protein | - |
| M8850_RS07685 (M8850_07685) | - | 1599456..1600418 (+) | 963 | WP_005755570.1 | hypothetical protein | - |
| M8850_RS07690 (M8850_07690) | - | 1600426..1602105 (+) | 1680 | WP_005755569.1 | hypothetical protein | - |
| M8850_RS07695 (M8850_07695) | - | 1602130..1602939 (+) | 810 | WP_005755567.1 | phage BR0599 family protein | - |
| M8850_RS07700 (M8850_07700) | - | 1602956..1603207 (+) | 252 | WP_005755565.1 | hypothetical protein | - |
| M8850_RS07705 (M8850_07705) | - | 1603211..1603411 (+) | 201 | WP_005755563.1 | hypothetical protein | - |
| M8850_RS07710 (M8850_07710) | - | 1603411..1606212 (+) | 2802 | WP_250028294.1 | phage tail protein | - |
| M8850_RS07715 (M8850_07715) | - | 1606278..1606538 (+) | 261 | WP_005755559.1 | Gp49 family protein | - |
| M8850_RS07720 (M8850_07720) | - | 1606690..1607535 (+) | 846 | WP_005755558.1 | hypothetical protein | - |
| M8850_RS07725 (M8850_07725) | - | 1607838..1608257 (+) | 420 | WP_005719426.1 | DUF417 family protein | - |
| M8850_RS07730 (M8850_07730) | lipA | 1608335..1609297 (-) | 963 | WP_005755556.1 | lipoyl synthase | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18657.68 Da Isoelectric Point: 5.3353
>NTDB_id=691199 M8850_RS07440 WP_005725039.1 1565648..1566148(+) (ssb) [Pasteurella multocida strain 32985]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=691199 M8850_RS07440 WP_005725039.1 1565648..1566148(+) (ssb) [Pasteurella multocida strain 32985]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTCTAA
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
69.231 |
100 |
0.759 |
| ssb | Vibrio cholerae strain A1552 |
53.591 |
100 |
0.584 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.47 |