Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M8850_RS03175 | Genome accession | NZ_CP097610 |
| Coordinates | 670582..671034 (-) | Length | 150 a.a. |
| NCBI ID | WP_250190659.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 32985 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 664133..709332 | 670582..671034 | within | 0 |
Gene organization within MGE regions
Location: 664133..709332
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8850_RS03110 (M8850_03110) | - | 664133..665164 (-) | 1032 | WP_250190649.1 | tyrosine-type recombinase/integrase | - |
| M8850_RS03115 (M8850_03115) | - | 665166..665417 (-) | 252 | WP_042742798.1 | DUF4224 domain-containing protein | - |
| M8850_RS03120 (M8850_03120) | - | 665454..665753 (-) | 300 | WP_250190650.1 | hypothetical protein | - |
| M8850_RS03125 (M8850_03125) | - | 665757..666050 (-) | 294 | WP_250190651.1 | hypothetical protein | - |
| M8850_RS03130 (M8850_03130) | - | 666054..666260 (-) | 207 | WP_250190652.1 | hypothetical protein | - |
| M8850_RS03135 (M8850_03135) | - | 666372..667463 (-) | 1092 | WP_250190653.1 | RelA/SpoT domain-containing protein | - |
| M8850_RS03140 (M8850_03140) | rdgC | 667811..668713 (-) | 903 | WP_250190654.1 | recombination-associated protein RdgC | - |
| M8850_RS03145 (M8850_03145) | - | 668716..669099 (-) | 384 | WP_078836134.1 | hypothetical protein | - |
| M8850_RS03150 (M8850_03150) | - | 669110..669409 (-) | 300 | WP_250190655.1 | hypothetical protein | - |
| M8850_RS03155 (M8850_03155) | - | 669488..669832 (-) | 345 | WP_250190656.1 | hypothetical protein | - |
| M8850_RS03160 (M8850_03160) | - | 669853..670116 (-) | 264 | WP_250190657.1 | hypothetical protein | - |
| M8850_RS03165 (M8850_03165) | - | 670147..670356 (-) | 210 | WP_250190658.1 | hypothetical protein | - |
| M8850_RS03170 (M8850_03170) | - | 670358..670540 (-) | 183 | WP_211634800.1 | hypothetical protein | - |
| M8850_RS03175 (M8850_03175) | ssb | 670582..671034 (-) | 453 | WP_250190659.1 | single-stranded DNA-binding protein | Machinery gene |
| M8850_RS03180 (M8850_03180) | - | 671038..671649 (-) | 612 | WP_211634799.1 | YqaJ viral recombinase family protein | - |
| M8850_RS03185 (M8850_03185) | bet | 671646..672428 (-) | 783 | WP_211634798.1 | phage recombination protein Bet | - |
| M8850_RS03190 (M8850_03190) | - | 672438..673370 (-) | 933 | WP_211634797.1 | hypothetical protein | - |
| M8850_RS03195 (M8850_03195) | - | 673373..673534 (-) | 162 | WP_165523898.1 | hypothetical protein | - |
| M8850_RS03200 (M8850_03200) | - | 673544..673783 (-) | 240 | WP_108574998.1 | hypothetical protein | - |
| M8850_RS03210 (M8850_03210) | - | 674208..674435 (-) | 228 | WP_250190660.1 | hypothetical protein | - |
| M8850_RS03215 (M8850_03215) | - | 674960..676894 (+) | 1935 | WP_250190661.1 | ATP-binding protein | - |
| M8850_RS03220 (M8850_03220) | - | 677046..677591 (-) | 546 | WP_115098348.1 | hypothetical protein | - |
| M8850_RS03225 (M8850_03225) | - | 677628..678590 (-) | 963 | WP_115098347.1 | hypothetical protein | - |
| M8850_RS03230 (M8850_03230) | - | 678663..679352 (-) | 690 | WP_250190662.1 | helix-turn-helix transcriptional regulator | - |
| M8850_RS03235 (M8850_03235) | - | 679480..679689 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| M8850_RS03240 (M8850_03240) | - | 679738..680190 (+) | 453 | WP_250190663.1 | phage regulatory CII family protein | - |
| M8850_RS03245 (M8850_03245) | - | 680255..680392 (+) | 138 | WP_165544545.1 | hypothetical protein | - |
| M8850_RS03250 (M8850_03250) | - | 680436..680666 (+) | 231 | WP_250190664.1 | helix-turn-helix domain-containing protein | - |
| M8850_RS03255 (M8850_03255) | - | 680668..680805 (+) | 138 | WP_250190665.1 | hypothetical protein | - |
| M8850_RS03260 (M8850_03260) | - | 680786..681652 (+) | 867 | WP_250190666.1 | hypothetical protein | - |
| M8850_RS03265 (M8850_03265) | - | 681652..683088 (+) | 1437 | WP_223131912.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M8850_RS03270 (M8850_03270) | - | 683092..683517 (+) | 426 | WP_250190667.1 | recombination protein NinB | - |
| M8850_RS03275 (M8850_03275) | - | 683591..684172 (+) | 582 | WP_250190668.1 | recombination protein NinG | - |
| M8850_RS03280 (M8850_03280) | - | 684169..684672 (+) | 504 | WP_250011907.1 | antiterminator Q family protein | - |
| M8850_RS03290 (M8850_03290) | - | 684925..685185 (+) | 261 | WP_014391475.1 | holin | - |
| M8850_RS03295 (M8850_03295) | - | 685182..685712 (+) | 531 | WP_005725607.1 | lysozyme | - |
| M8850_RS03300 (M8850_03300) | - | 685685..686008 (+) | 324 | WP_078819738.1 | DUF2570 family protein | - |
| M8850_RS03305 (M8850_03305) | - | 685914..686195 (+) | 282 | WP_078819735.1 | hypothetical protein | - |
| M8850_RS03310 (M8850_03310) | - | 686228..686662 (-) | 435 | WP_096742995.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| M8850_RS03315 (M8850_03315) | - | 686691..686873 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| M8850_RS03320 (M8850_03320) | - | 687212..687688 (+) | 477 | WP_061406081.1 | DUF1441 family protein | - |
| M8850_RS03325 (M8850_03325) | - | 687691..689798 (+) | 2108 | Protein_634 | phage terminase large subunit family protein | - |
| M8850_RS03330 (M8850_03330) | - | 689795..690016 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| M8850_RS03335 (M8850_03335) | - | 690013..691547 (+) | 1535 | Protein_636 | phage portal protein | - |
| M8850_RS03340 (M8850_03340) | - | 691483..693492 (+) | 2010 | WP_250190622.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| M8850_RS03345 (M8850_03345) | - | 693562..693888 (+) | 327 | WP_016570083.1 | capsid cement protein | - |
| M8850_RS03350 (M8850_03350) | - | 693881..694174 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| M8850_RS03355 (M8850_03355) | - | 694174..694725 (+) | 552 | WP_250190623.1 | phage tail protein | - |
| M8850_RS03360 (M8850_03360) | gpU | 694722..695129 (+) | 408 | WP_115098330.1 | phage tail terminator protein | - |
| M8850_RS03365 (M8850_03365) | - | 695126..695635 (+) | 510 | WP_046339069.1 | phage tail tube protein | - |
| M8850_RS03370 (M8850_03370) | - | 695638..696027 (+) | 390 | WP_250190624.1 | phage minor tail protein G | - |
| M8850_RS03375 (M8850_03375) | - | 696048..696350 (+) | 303 | WP_258553973.1 | phage tail assembly protein T | - |
| M8850_RS03380 (M8850_03380) | - | 696337..698733 (+) | 2397 | WP_250190625.1 | phage tail length tape measure family protein | - |
| M8850_RS03385 (M8850_03385) | - | 698733..699080 (+) | 348 | WP_115098326.1 | phage tail protein | - |
| M8850_RS03390 (M8850_03390) | - | 699155..699709 (+) | 555 | WP_250190626.1 | UDP-N-acetylglucosamine acyltransferase | - |
| M8850_RS03395 (M8850_03395) | - | 699758..700408 (+) | 651 | WP_250190627.1 | phage minor tail protein L | - |
| M8850_RS03400 (M8850_03400) | - | 700410..701123 (+) | 714 | WP_250190628.1 | C40 family peptidase | - |
| M8850_RS03405 (M8850_03405) | - | 701056..701775 (+) | 720 | WP_250012425.1 | tail assembly protein | - |
| M8850_RS11770 | - | 701779..703062 (+) | 1284 | WP_284150285.1 | phage tail protein | - |
| M8850_RS03410 (M8850_03410) | - | 702996..705425 (+) | 2430 | WP_284150286.1 | phage tail protein | - |
| M8850_RS03415 (M8850_03415) | - | 705439..706827 (+) | 1389 | WP_250190669.1 | pyocin knob domain-containing protein | - |
| M8850_RS03420 (M8850_03420) | - | 706880..707140 (+) | 261 | WP_250190670.1 | hypothetical protein | - |
| M8850_RS03425 (M8850_03425) | - | 707151..707750 (+) | 600 | Protein_655 | hypothetical protein | - |
| M8850_RS03430 (M8850_03430) | - | 707747..708208 (+) | 462 | WP_115098319.1 | enoyl-CoA hydratase | - |
| M8850_RS03435 (M8850_03435) | - | 708490..709332 (-) | 843 | WP_005754053.1 | patatin family protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16994.75 Da Isoelectric Point: 7.9749
>NTDB_id=691191 M8850_RS03175 WP_250190659.1 670582..671034(-) (ssb) [Pasteurella multocida strain 32985]
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQTPQNNAYANAKNGKPAQQQSDNFKDDDTPF
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQTPQNNAYANAKNGKPAQQQSDNFKDDDTPF
Nucleotide
Download Length: 453 bp
>NTDB_id=691191 M8850_RS03175 WP_250190659.1 670582..671034(-) (ssb) [Pasteurella multocida strain 32985]
ATGGCAGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCTACGAGCGAAAGTTGGATCGACAAAAACACCAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTGTATGTAGAAGGT
CGTTTAAAAACTCGCAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGACTCACAGCCACAGCAAGCACAGACACCACAAAACAATGCTTATGCGAATGCGAAAAATGGAA
AGCCAGCACAGCAACAGTCAGATAATTTTAAAGACGACGACACCCCATTCTGA
ATGGCAGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCTACGAGCGAAAGTTGGATCGACAAAAACACCAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTGTATGTAGAAGGT
CGTTTAAAAACTCGCAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGACTCACAGCCACAGCAAGCACAGACACCACAAAACAATGCTTATGCGAATGCGAAAAATGGAA
AGCCAGCACAGCAACAGTCAGATAATTTTAAAGACGACGACACCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
64.088 |
100 |
0.773 |
| ssb | Vibrio cholerae strain A1552 |
53.957 |
92.667 |
0.5 |
| ssb | Neisseria gonorrhoeae MS11 |
46.715 |
91.333 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
46.715 |
91.333 |
0.427 |